Homologs in group_3515

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_18045 FBDBKF_18045 100.0 Morganella morganii S1 hipB Transcriptional regulator, contains XRE-family HTH domain
NLDBIP_17705 NLDBIP_17705 100.0 Morganella morganii S4 hipB Transcriptional regulator, contains XRE-family HTH domain
LHKJJB_17625 LHKJJB_17625 100.0 Morganella morganii S3 hipB Transcriptional regulator, contains XRE-family HTH domain
HKOGLL_17440 HKOGLL_17440 100.0 Morganella morganii S5 hipB Transcriptional regulator, contains XRE-family HTH domain

Distribution of the homologs in the orthogroup group_3515

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3515

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0C5S2 1.13e-06 46 43 2 69 4 R00410 Uncharacterized HTH-type transcriptional regulator R00410 Rhizobium meliloti (strain 1021)
A6U5H5 1.13e-06 46 43 2 69 4 Smed_0045 Uncharacterized HTH-type transcriptional regulator Smed_0045 Sinorhizobium medicae (strain WSM419)
Q8NTD8 1.39e-05 44 32 1 67 2 ramB HTH-type transcriptional regulator RamB Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
P15017 3.01e-05 42 30 1 81 4 None Uncharacterized transcriptional regulator in ATPase CF(0) region Rhodospirillum rubrum
P55681 7.05e-05 42 31 1 69 4 NGR_a01020 Uncharacterized HTH-type transcriptional regulator y4wC Sinorhizobium fredii (strain NBRC 101917 / NGR234)
B8GI76 0.000446 40 35 1 67 3 Mpal_0031 Putative HTH-type transcriptional regulatory protein Mpal_0031 Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_16745
Feature type CDS
Gene hipB
Product Transcriptional regulator, contains XRE-family HTH domain
Location 11172 - 11441 (strand: -1)
Length 270 (nucleotides) / 89 (amino acids)

Contig

Accession ZDB_230
Length 55766 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3515
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Domains

PF01381 Helix-turn-helix

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1396 Transcription (K) K Transcriptional regulator, contains XRE-family HTH domain

Protein Sequence

MKNNQILLHDVGALIRKLRKEKRMSGVDLGAELGISQQQISRYENATSEISVSTLINILAVFNITPAEFFTRISDTKHDFFSKYTTGNW

Flanking regions ( +/- flanking 50bp)

TAAACACATCACACCTGAATCCTGTTATGGCCCGGGGAGTGGAATCTATTATGAAAAATAATCAAATATTACTGCATGATGTAGGCGCACTGATCCGAAAGTTACGTAAAGAAAAAAGAATGAGCGGCGTTGATCTTGGCGCGGAACTGGGAATCAGCCAGCAACAGATCTCCCGCTATGAAAATGCCACGAGTGAAATATCAGTCTCAACACTCATTAATATACTTGCTGTATTTAATATAACACCCGCTGAATTTTTTACCCGTATCTCTGATACGAAACATGATTTTTTCAGCAAATACACCACCGGGAACTGGTAAATACCAGCCAATTAGTCCGTTAATTATTGTTGTTATGCATCAGGAAGATA