Homologs in group_144

Help

9 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09105 FBDBKF_09105 100.0 Morganella morganii S1 fimA Pilin (type 1 fimbrial protein)
EHELCC_10305 EHELCC_10305 100.0 Morganella morganii S2 fimA Pilin (type 1 fimbrial protein)
LHKJJB_10705 LHKJJB_10705 100.0 Morganella morganii S3 fimA Pilin (type 1 fimbrial protein)
HKOGLL_13765 HKOGLL_13765 100.0 Morganella morganii S5 fimA Pilin (type 1 fimbrial protein)
F4V73_RS00870 F4V73_RS00870 30.2 Morganella psychrotolerans - fimbrial protein
F4V73_RS01055 F4V73_RS01055 20.1 Morganella psychrotolerans - fimbrial protein
F4V73_RS01850 F4V73_RS01850 24.1 Morganella psychrotolerans - fimbrial protein
F4V73_RS09385 F4V73_RS09385 30.7 Morganella psychrotolerans - fimbrial protein
F4V73_RS10845 F4V73_RS10845 83.2 Morganella psychrotolerans - fimbrial protein

Distribution of the homologs in the orthogroup group_144

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_144

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P12730 3.94e-13 67 31 7 187 1 sfaA S-fimbrial protein subunit SfaA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P12267 1.19e-11 63 26 7 203 3 mrkA Fimbrial subunit type 3 Klebsiella pneumoniae
P43660 3.51e-08 53 27 6 179 3 lpfA Long polar fimbria protein A Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P37922 9.61e-08 52 23 5 177 3 fimI Fimbrin-like protein FimI Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q03011 2.75e-07 51 27 6 181 1 mrpA Major MR/P fimbria protein Proteus mirabilis (strain HI4320)
Q08456 6.22e-07 50 22 5 177 5 fimI Putative fimbrin-like protein FimI Salmonella typhi
P62605 1.34e-06 49 26 8 188 3 pilC Type-1 fimbrial protein, C chain Escherichia coli
P62606 1.34e-06 49 26 8 188 3 pilC Type-1 fimbrial protein, C chain Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P39264 2.58e-06 48 23 5 184 1 fimI Fimbrin-like protein FimI Escherichia coli (strain K12)
Q47223 5.79e-06 48 22 4 140 1 fimA Type-1 fimbrial protein, A chain Escherichia coli
P37921 1.13e-05 47 24 5 189 1 fimA Type-1 fimbrial protein, A chain Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P12903 1.85e-05 46 26 7 168 1 fim Fimbrial subunit type 1 Klebsiella pneumoniae
P37920 1.87e-05 46 24 5 189 3 fimA Type-1 fimbrial protein, A chain Salmonella typhi
P37050 1.9e-05 46 29 13 199 2 yadN Uncharacterized fimbrial-like protein YadN Escherichia coli (strain K12)
P04128 5.2e-05 45 22 4 136 1 fimA Type-1 fimbrial protein, A chain Escherichia coli (strain K12)
P12266 0.000204 43 22 4 140 1 None Fimbrial subunit type 1 Klebsiella pneumoniae

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_10650
Feature type CDS
Gene fimA
Product Pilin (type 1 fimbrial protein)
Location 78296 - 78850 (strand: -1)
Length 555 (nucleotides) / 184 (amino acids)
In genomic island -

Contig

Accession ZDB_525
Length 191527 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_144
Orthogroup size 10
N. genomes 6

Actions

Genomic region

Domains

PF00419 Fimbrial protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3539 Cell motility (N) N Pilin (type 1 fimbrial protein)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07345 major type 1 subunit fimbrin (pilin) Shigellosis
Pertussis
-

Protein Sequence

MNKKFALAASLSLIFVANSASAATTASGGSINFTGFITDATCTINNGNANMSVLLDPITVNQITHSGAIEEGKKAFSLELSDCNASNKDKKSLHINFASTNLIANNGNYLINQETDEKGNHKNVGIALTSQKSDEVINLNTPYDTKIIADNGVMQFYAKYYKVGSEPAQPGKINTMLTYNLSYF

Flanking regions ( +/- flanking 50bp)

TAATTAATTTCGTTTCCGTATTTATTATATATTCCATCCCGGAGAGGATAATGAATAAAAAATTCGCTCTTGCAGCGTCTCTTTCCCTTATTTTTGTTGCTAACTCTGCGTCTGCGGCGACTACCGCATCCGGTGGTTCAATCAATTTCACCGGTTTTATTACTGATGCTACCTGCACCATTAATAACGGTAATGCGAACATGTCGGTATTATTAGACCCGATTACTGTCAATCAGATCACACATTCCGGCGCAATCGAGGAAGGAAAGAAAGCATTTTCTCTCGAATTATCAGACTGTAATGCCAGTAATAAAGATAAAAAATCACTGCATATTAATTTCGCATCCACCAACCTTATTGCCAATAACGGTAATTACCTGATCAACCAGGAAACGGATGAGAAAGGCAATCATAAAAATGTCGGGATTGCGTTAACATCACAAAAAAGTGATGAAGTTATTAATTTAAACACGCCATACGATACAAAAATCATTGCTGATAATGGTGTTATGCAGTTTTATGCAAAATATTACAAAGTCGGCAGCGAACCGGCTCAGCCGGGTAAAATCAATACCATGCTGACATATAACCTGTCTTACTTCTGATATTTTCAGGCCTCTTTAATTCAGGGGCCTGATTTTTGAAAATACACATC