Homologs in group_779

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03605 FBDBKF_03605 100.0 Morganella morganii S1 frdB succinate dehydrogenase/fumarate reductase iron-sulfur subunit
EHELCC_06930 EHELCC_06930 100.0 Morganella morganii S2 frdB succinate dehydrogenase/fumarate reductase iron-sulfur subunit
LHKJJB_06790 LHKJJB_06790 100.0 Morganella morganii S3 frdB succinate dehydrogenase/fumarate reductase iron-sulfur subunit
HKOGLL_04140 HKOGLL_04140 100.0 Morganella morganii S5 frdB succinate dehydrogenase/fumarate reductase iron-sulfur subunit
F4V73_RS11265 F4V73_RS11265 94.7 Morganella psychrotolerans - succinate dehydrogenase/fumarate reductase iron-sulfur subunit
PMI_RS17845 PMI_RS17845 87.3 Proteus mirabilis HI4320 - succinate dehydrogenase/fumarate reductase iron-sulfur subunit

Distribution of the homologs in the orthogroup group_779

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_779

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P20921 4.65e-166 461 87 0 242 3 frdB Fumarate reductase iron-sulfur subunit Proteus vulgaris
P0AC50 2.85e-154 431 80 0 244 3 frdB Fumarate reductase iron-sulfur subunit Shigella flexneri
P0AC47 2.85e-154 431 80 0 244 1 frdB Fumarate reductase iron-sulfur subunit Escherichia coli (strain K12)
P0AC48 2.85e-154 431 80 0 244 3 frdB Fumarate reductase iron-sulfur subunit Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AC49 2.85e-154 431 80 0 244 3 frdB Fumarate reductase iron-sulfur subunit Escherichia coli O157:H7
P44893 2.21e-134 381 69 1 255 3 frdB Fumarate reductase iron-sulfur subunit Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P9WN89 3.13e-81 246 48 2 242 1 frdB Fumarate reductase iron-sulfur subunit Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WN88 3.13e-81 246 48 2 242 3 frdB Fumarate reductase iron-sulfur subunit Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q8ZQU2 2.62e-41 144 38 4 230 3 sdhB Succinate dehydrogenase iron-sulfur subunit Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P07014 3.43e-41 144 38 4 230 1 sdhB Succinate dehydrogenase iron-sulfur subunit Escherichia coli (strain K12)
Q70KF8 7.95e-39 139 36 5 230 3 SDH2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Uromyces fabae
Q4UN71 9.01e-39 138 32 2 235 3 sdhB Succinate dehydrogenase iron-sulfur subunit Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
P51053 1.08e-38 137 36 4 224 3 sdhB Succinate dehydrogenase iron-sulfur subunit Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q92JJ8 2.54e-38 137 31 2 235 3 sdhB Succinate dehydrogenase iron-sulfur subunit Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q1RGP3 4.12e-38 136 31 2 233 3 sdhB Succinate dehydrogenase iron-sulfur subunit Rickettsia bellii (strain RML369-C)
Q9ZEA1 1.08e-37 135 32 3 240 3 sdhB Succinate dehydrogenase iron-sulfur subunit Rickettsia prowazekii (strain Madrid E)
Q8LBZ7 1.31e-37 135 34 4 224 1 SDH2-1 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 1, mitochondrial Arabidopsis thaliana
Q68XS0 2.45e-37 134 31 2 235 3 sdhB Succinate dehydrogenase iron-sulfur subunit Rickettsia typhi (strain ATCC VR-144 / Wilmington)
P80480 3.36e-37 133 32 3 227 3 SDH2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit Reclinomonas americana
P32420 3.75e-37 135 33 5 227 3 SDH2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Ustilago maydis (strain 521 / FGSC 9021)
Q9S827 5.33e-37 134 35 4 230 1 SDH2-1 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 1, mitochondrial Oryza sativa subsp. japonica
Q8LB02 1.27e-36 133 34 4 224 1 SDH2-2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 2, mitochondrial Arabidopsis thaliana
Q59662 3.99e-36 131 33 3 224 3 sdhB Succinate dehydrogenase iron-sulfur subunit Paracoccus denitrificans
O42772 5.53e-36 132 33 4 236 3 SDH2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Zymoseptoria tritici
P21911 2.74e-34 127 34 4 226 3 sdh2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P80477 3.02e-34 126 35 2 196 3 SDH2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit Porphyra purpurea
P21914 1.64e-33 125 33 6 237 2 SdhB Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Drosophila melanogaster
Q55CC2 8.1e-33 123 33 5 240 3 sdhB Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Dictyostelium discoideum
Q75CI4 1.67e-32 122 34 6 230 3 SDH2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
P21801 1.96e-32 122 33 6 234 1 SDH2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
B0BM36 2.4e-32 122 32 6 235 2 sdhb Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Xenopus tropicalis
Q3T189 4.92e-32 121 31 6 236 1 SDHB Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Bos taurus
Q6H4G3 6.54e-32 122 33 7 230 1 SDH2-2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 2, mitochondrial Oryza sativa subsp. japonica
A8WPF0 1.05e-31 120 32 6 233 3 sdhb-1 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Caenorhabditis briggsae
Q09545 1.13e-31 120 32 6 233 2 sdhb-1 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Caenorhabditis elegans
Q9ZMP1 2.74e-31 118 30 6 231 3 frdB Fumarate reductase iron-sulfur subunit Helicobacter pylori (strain J99 / ATCC 700824)
Q007T0 3e-31 119 32 7 238 1 SDHB Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Sus scrofa
Q9CQA3 3.48e-31 119 32 6 235 1 Sdhb Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Mus musculus
Q9FJP9 6.02e-31 119 33 7 230 1 SDH2-3 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 3, mitochondrial Arabidopsis thaliana
Q6FWS8 6.4e-31 117 31 6 236 3 SDH2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138)
Q3B8J8 7.2e-31 118 31 6 235 2 sdhb Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Xenopus laevis
P21912 7.51e-31 118 31 6 235 1 SDHB Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Homo sapiens
O44074 1.34e-30 117 32 5 230 1 SDHB Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Ascaris suum
O06914 1.93e-30 116 28 5 226 3 frdB Fumarate reductase iron-sulfur subunit Helicobacter pylori (strain ATCC 700392 / 26695)
Q9YHT2 2.07e-30 117 32 5 237 1 SDHB Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Gallus gallus
P48933 2.98e-30 116 30 3 231 3 SDH2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit Cyanidium caldarium
P48932 3.62e-30 115 31 3 223 3 SDH2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit Chondrus crispus
D9PUX5 5.47e-30 119 29 5 231 1 tfrB Fumarate reductase (CoM/CoB) subunit B Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
Q57557 1.64e-29 118 32 7 228 3 MJ0092 Uncharacterized iron-sulfur protein MJ0092 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
A5PL98 2.14e-29 114 31 6 232 2 sdhb Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Danio rerio
P17596 2.48e-29 113 29 5 220 1 frdB Fumarate reductase iron-sulfur subunit Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
P21913 2.59e-29 114 31 6 235 2 Sdhb Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Rattus norvegicus
P08066 1.6e-26 106 25 5 234 3 sdhB Succinate dehydrogenase iron-sulfur subunit Bacillus subtilis (strain 168)
Q6LYC4 6.39e-26 108 33 5 197 3 MMP1067 Uncharacterized iron-sulfur protein MMP1067 Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
Q7M826 4.58e-24 101 34 4 200 1 sdhB 8-methylmenaquinol:fumarate reductase iron-sulfur subunit Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_07255
Feature type CDS
Gene frdB
Product succinate dehydrogenase/fumarate reductase iron-sulfur subunit
Location 118747 - 119481 (strand: -1)
Length 735 (nucleotides) / 244 (amino acids)

Contig

Accession ZDB_522
Length 269640 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_779
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF13085 2Fe-2S iron-sulfur cluster binding domain
PF13237 4Fe-4S dicluster domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0479 Energy production and conversion (C) C Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit

Kegg Ortholog Annotation(s)

Protein Sequence

MAEMKMLKMSVMRYNPETDNEPHAVTYQVPYDEQTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNKVPKLACKTFLREYPQGMDIEALGNFPVERDLVVDMTHFIESLEAIKPYIIGNDRKPSEGPNNQTPGQMAKYHQFSGCINCGLCYAACPQFGLNPEFLGPGVLTLAQRYNTDSRDHGKKERMKQINGDNGVWTCTFVGYCSEVCPKHVDPAAAIQQGKAASAEDYIIARLKPQ

Flanking regions ( +/- flanking 50bp)

TGGTGAAGCGGCAGCGGCTGAACAGGCGGCAAAAGAGAAGGAAAACGTCAATGGCTGAGATGAAAATGCTGAAAATGTCAGTGATGCGCTATAACCCGGAAACGGATAATGAGCCGCATGCTGTCACGTATCAGGTGCCTTACGATGAGCAGACCTCACTGCTGGATGCGCTGGGCTATATCAAAGACAACCTGGCGCCGGATCTCTCCTACCGCTGGTCCTGCCGGATGGCTATCTGCGGCTCCTGCGGCATGATGGTCAATAAGGTGCCGAAGCTCGCCTGTAAAACCTTCCTGCGCGAATATCCGCAGGGCATGGACATTGAGGCACTCGGCAACTTCCCGGTCGAACGCGACCTGGTTGTGGATATGACGCACTTTATCGAGAGCCTGGAAGCTATCAAGCCTTATATTATCGGCAATGACCGCAAACCGTCCGAAGGCCCGAATAACCAGACTCCGGGACAGATGGCAAAATACCATCAGTTCTCCGGCTGCATTAACTGCGGTCTGTGCTACGCGGCCTGTCCGCAGTTTGGTCTGAATCCGGAATTCCTCGGCCCGGGTGTGCTGACACTGGCACAGCGCTATAACACCGACAGCCGCGATCACGGTAAAAAAGAGCGGATGAAACAAATCAACGGCGATAACGGCGTATGGACCTGTACCTTCGTGGGTTACTGCTCGGAAGTCTGTCCGAAACATGTGGACCCGGCAGCCGCTATTCAGCAGGGTAAAGCCGCCAGTGCGGAAGATTACATTATTGCCCGTCTGAAACCACAATAAGGAAGAGAGAAATGACGACCAAACGTAAGCCTTATGTGCGTGAAATGACA