Homologs in group_849

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03605 FBDBKF_03605 87.3 Morganella morganii S1 frdB succinate dehydrogenase/fumarate reductase iron-sulfur subunit
EHELCC_06930 EHELCC_06930 87.3 Morganella morganii S2 frdB succinate dehydrogenase/fumarate reductase iron-sulfur subunit
NLDBIP_07255 NLDBIP_07255 87.3 Morganella morganii S4 frdB succinate dehydrogenase/fumarate reductase iron-sulfur subunit
LHKJJB_06790 LHKJJB_06790 87.3 Morganella morganii S3 frdB succinate dehydrogenase/fumarate reductase iron-sulfur subunit
HKOGLL_04140 HKOGLL_04140 87.3 Morganella morganii S5 frdB succinate dehydrogenase/fumarate reductase iron-sulfur subunit
F4V73_RS11265 F4V73_RS11265 87.3 Morganella psychrotolerans - succinate dehydrogenase/fumarate reductase iron-sulfur subunit

Distribution of the homologs in the orthogroup group_849

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_849

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P20921 0.0 517 100 0 245 3 frdB Fumarate reductase iron-sulfur subunit Proteus vulgaris
P0AC50 1.14e-156 437 82 0 242 3 frdB Fumarate reductase iron-sulfur subunit Shigella flexneri
P0AC47 1.14e-156 437 82 0 242 1 frdB Fumarate reductase iron-sulfur subunit Escherichia coli (strain K12)
P0AC48 1.14e-156 437 82 0 242 3 frdB Fumarate reductase iron-sulfur subunit Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AC49 1.14e-156 437 82 0 242 3 frdB Fumarate reductase iron-sulfur subunit Escherichia coli O157:H7
P44893 2.28e-136 386 72 1 249 3 frdB Fumarate reductase iron-sulfur subunit Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P9WN89 4.17e-89 266 52 2 242 1 frdB Fumarate reductase iron-sulfur subunit Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WN88 4.17e-89 266 52 2 242 3 frdB Fumarate reductase iron-sulfur subunit Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P07014 1.65e-43 150 38 4 235 1 sdhB Succinate dehydrogenase iron-sulfur subunit Escherichia coli (strain K12)
Q8ZQU2 1.29e-41 145 37 4 234 3 sdhB Succinate dehydrogenase iron-sulfur subunit Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P51053 2.44e-41 144 37 4 228 3 sdhB Succinate dehydrogenase iron-sulfur subunit Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
P32420 3.21e-39 140 34 6 229 3 SDH2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Ustilago maydis (strain 521 / FGSC 9021)
Q92JJ8 6.32e-39 139 32 2 233 3 sdhB Succinate dehydrogenase iron-sulfur subunit Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q8LBZ7 7.75e-39 139 34 4 226 1 SDH2-1 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 1, mitochondrial Arabidopsis thaliana
O42772 8.06e-39 139 34 4 238 3 SDH2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Zymoseptoria tritici
Q70KF8 8.1e-39 139 35 5 230 3 SDH2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Uromyces fabae
Q4UN71 1.23e-38 138 31 2 233 3 sdhB Succinate dehydrogenase iron-sulfur subunit Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q68XS0 4.2e-38 136 31 2 233 3 sdhB Succinate dehydrogenase iron-sulfur subunit Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q9ZEA1 4.38e-38 136 32 2 233 3 sdhB Succinate dehydrogenase iron-sulfur subunit Rickettsia prowazekii (strain Madrid E)
Q1RGP3 9.66e-38 135 31 2 229 3 sdhB Succinate dehydrogenase iron-sulfur subunit Rickettsia bellii (strain RML369-C)
Q8LB02 1.57e-37 135 34 4 226 1 SDH2-2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 2, mitochondrial Arabidopsis thaliana
Q59662 2e-37 135 34 3 224 3 sdhB Succinate dehydrogenase iron-sulfur subunit Paracoccus denitrificans
Q9S827 1.11e-36 133 36 4 225 1 SDH2-1 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 1, mitochondrial Oryza sativa subsp. japonica
P21911 1.7e-35 130 34 4 228 3 sdh2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P80480 2.18e-35 129 31 3 223 3 SDH2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit Reclinomonas americana
Q9ZMP1 3.17e-35 129 32 6 236 3 frdB Fumarate reductase iron-sulfur subunit Helicobacter pylori (strain J99 / ATCC 700824)
A8WPF0 4.09e-35 129 34 6 229 3 sdhb-1 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Caenorhabditis briggsae
Q09545 6.89e-35 129 34 6 229 2 sdhb-1 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Caenorhabditis elegans
P80477 8.63e-35 127 32 3 223 3 SDH2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit Porphyra purpurea
Q55CC2 9.85e-35 128 34 6 240 3 sdhB Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Dictyostelium discoideum
P21914 2.53e-34 127 34 6 232 2 SdhB Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Drosophila melanogaster
Q75CI4 4.5e-34 126 35 6 234 3 SDH2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
O06914 5.77e-34 125 30 5 231 3 frdB Fumarate reductase iron-sulfur subunit Helicobacter pylori (strain ATCC 700392 / 26695)
O44074 1.34e-33 125 34 6 231 1 SDHB Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Ascaris suum
Q6H4G3 1.49e-33 126 35 7 230 1 SDH2-2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 2, mitochondrial Oryza sativa subsp. japonica
B0BM36 3.88e-33 124 33 6 232 2 sdhb Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Xenopus tropicalis
Q3T189 9.01e-33 123 32 6 233 1 SDHB Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Bos taurus
P21912 1.51e-32 122 33 6 232 1 SDHB Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Homo sapiens
P21801 1.91e-32 122 33 6 230 1 SDH2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q9CQA3 2.34e-32 122 33 6 232 1 Sdhb Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Mus musculus
Q9FJP9 4.07e-32 122 34 8 234 1 SDH2-3 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 3, mitochondrial Arabidopsis thaliana
Q007T0 5.17e-32 121 32 6 232 1 SDHB Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Sus scrofa
P48932 9.57e-32 120 31 3 223 3 SDH2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit Chondrus crispus
D9PUX5 1.1e-31 124 30 5 230 1 tfrB Fumarate reductase (CoM/CoB) subunit B Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
Q3B8J8 1.12e-31 120 32 7 243 2 sdhb Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Xenopus laevis
A5PL98 4.27e-31 119 32 6 228 2 sdhb Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Danio rerio
Q6FWS8 4.73e-31 118 31 6 232 3 SDH2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138)
P17596 4.88e-31 117 29 5 220 1 frdB Fumarate reductase iron-sulfur subunit Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q9YHT2 4.97e-31 119 32 5 231 1 SDHB Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Gallus gallus
P48933 8.89e-31 117 30 3 229 3 SDH2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit Cyanidium caldarium
P21913 2.02e-30 117 32 6 229 2 Sdhb Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Rattus norvegicus
Q57557 9.83e-29 116 32 7 227 3 MJ0092 Uncharacterized iron-sulfur protein MJ0092 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q6LYC4 1.3e-25 107 34 6 200 3 MMP1067 Uncharacterized iron-sulfur protein MMP1067 Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
P08066 1.58e-25 103 25 5 232 3 sdhB Succinate dehydrogenase iron-sulfur subunit Bacillus subtilis (strain 168)
Q7M826 9.82e-25 102 34 5 202 1 sdhB 8-methylmenaquinol:fumarate reductase iron-sulfur subunit Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS17845
Feature type CDS
Gene -
Product succinate dehydrogenase/fumarate reductase iron-sulfur subunit
Location 3917784 - 3918521 (strand: -1)
Length 738 (nucleotides) / 245 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_849
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF13085 2Fe-2S iron-sulfur cluster binding domain
PF13237 4Fe-4S dicluster domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0479 Energy production and conversion (C) C Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit

Kegg Ortholog Annotation(s)

Protein Sequence

MADDMKHVKMEVMRYNPETDDAPHFVTYDVPYDEQTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNRVPKLACKTFMRDYPNGVRIEALGNFPVERDLVVDMTHFIESLEAIKPYILGNDRKPSEGPNKQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAQRYNTDSRDHGAKERMPQLNGENGVWSCTFVGYCSEVCPKHVDPAAAIQQGKAASAQDFVIAMLKPR

Flanking regions ( +/- flanking 50bp)

CTATGGTGGTGAAGCGACTGCACAAGACAAGCAGAATAAGGAGAAAGCGAATGGCTGATGACATGAAGCACGTTAAGATGGAAGTCATGCGCTATAACCCCGAAACGGATGATGCGCCTCATTTCGTCACTTATGATGTGCCTTACGATGAGCAAACCTCATTATTGGATGCATTGGGTTATATTAAAGATAACTTAGCGCCAGATCTGTCTTACCGTTGGTCTTGCCGTATGGCGATTTGTGGCTCTTGCGGCATGATGGTTAACCGAGTCCCAAAACTGGCTTGTAAAACCTTTATGCGTGACTACCCAAATGGGGTGAGAATCGAAGCGTTAGGTAACTTCCCTGTCGAGCGCGACCTTGTCGTCGATATGACTCACTTTATTGAAAGCTTAGAAGCGATTAAACCTTACATTTTAGGAAATGATCGTAAGCCTTCAGAAGGTCCAAATAAACAGACTCCTGCTCAAATGGCGAAATACCACCAATTCTCTGGTTGTATCAACTGTGGTTTATGCTATGCAGCATGTCCTCAGTTTGGTTTAAATCCTGAGTTTATTGGTCCTGCAGCGATTACGTTAGCACAACGTTACAATACCGATAGCCGTGACCATGGGGCTAAAGAGCGTATGCCTCAATTAAATGGTGAGAATGGCGTCTGGTCTTGTACTTTCGTGGGCTACTGCTCTGAAGTCTGTCCAAAACATGTGGATCCTGCTGCGGCTATTCAGCAGGGTAAAGCAGCCAGTGCGCAAGACTTTGTCATTGCCATGCTGAAACCACGTTAAGGAGGAAACAAGACATGACAACAAAACGTAAGCCTTATGTTCGTGGTATG