Homologs in group_849

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03605 FBDBKF_03605 94.7 Morganella morganii S1 frdB succinate dehydrogenase/fumarate reductase iron-sulfur subunit
EHELCC_06930 EHELCC_06930 94.7 Morganella morganii S2 frdB succinate dehydrogenase/fumarate reductase iron-sulfur subunit
NLDBIP_07255 NLDBIP_07255 94.7 Morganella morganii S4 frdB succinate dehydrogenase/fumarate reductase iron-sulfur subunit
LHKJJB_06790 LHKJJB_06790 94.7 Morganella morganii S3 frdB succinate dehydrogenase/fumarate reductase iron-sulfur subunit
HKOGLL_04140 HKOGLL_04140 94.7 Morganella morganii S5 frdB succinate dehydrogenase/fumarate reductase iron-sulfur subunit
PMI_RS17845 PMI_RS17845 87.3 Proteus mirabilis HI4320 - succinate dehydrogenase/fumarate reductase iron-sulfur subunit

Distribution of the homologs in the orthogroup group_849

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_849

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P20921 1.06e-165 460 87 0 242 3 frdB Fumarate reductase iron-sulfur subunit Proteus vulgaris
P0AC50 9.93e-156 435 80 0 244 3 frdB Fumarate reductase iron-sulfur subunit Shigella flexneri
P0AC47 9.93e-156 435 80 0 244 1 frdB Fumarate reductase iron-sulfur subunit Escherichia coli (strain K12)
P0AC48 9.93e-156 435 80 0 244 3 frdB Fumarate reductase iron-sulfur subunit Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AC49 9.93e-156 435 80 0 244 3 frdB Fumarate reductase iron-sulfur subunit Escherichia coli O157:H7
P44893 1.26e-133 379 69 1 255 3 frdB Fumarate reductase iron-sulfur subunit Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P9WN89 4.96e-83 251 50 2 242 1 frdB Fumarate reductase iron-sulfur subunit Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WN88 4.96e-83 251 50 2 242 3 frdB Fumarate reductase iron-sulfur subunit Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P07014 6.9e-41 143 38 4 229 1 sdhB Succinate dehydrogenase iron-sulfur subunit Escherichia coli (strain K12)
Q8ZQU2 3.93e-40 141 38 4 229 3 sdhB Succinate dehydrogenase iron-sulfur subunit Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q70KF8 4.76e-39 139 36 5 226 3 SDH2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Uromyces fabae
P51053 4.82e-39 138 37 4 224 3 sdhB Succinate dehydrogenase iron-sulfur subunit Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q4UN71 2.99e-38 137 32 2 233 3 sdhB Succinate dehydrogenase iron-sulfur subunit Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q92JJ8 9.17e-38 135 32 2 233 3 sdhB Succinate dehydrogenase iron-sulfur subunit Rickettsia conorii (strain ATCC VR-613 / Malish 7)
P32420 1.76e-37 135 34 5 227 3 SDH2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Ustilago maydis (strain 521 / FGSC 9021)
Q9S827 1.94e-37 135 36 4 230 1 SDH2-1 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 1, mitochondrial Oryza sativa subsp. japonica
Q1RGP3 1.98e-37 135 32 2 231 3 sdhB Succinate dehydrogenase iron-sulfur subunit Rickettsia bellii (strain RML369-C)
Q8LBZ7 2.12e-37 135 34 4 224 1 SDH2-1 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 1, mitochondrial Arabidopsis thaliana
Q9ZEA1 2.45e-37 134 32 3 238 3 sdhB Succinate dehydrogenase iron-sulfur subunit Rickettsia prowazekii (strain Madrid E)
P80480 1.02e-36 132 32 3 227 3 SDH2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit Reclinomonas americana
Q68XS0 1.04e-36 133 31 2 233 3 sdhB Succinate dehydrogenase iron-sulfur subunit Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q8LB02 1.81e-36 132 34 4 224 1 SDH2-2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 2, mitochondrial Arabidopsis thaliana
O42772 1.83e-36 133 33 4 236 3 SDH2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Zymoseptoria tritici
Q59662 1.67e-35 129 32 4 236 3 sdhB Succinate dehydrogenase iron-sulfur subunit Paracoccus denitrificans
P21911 1.3e-34 128 34 4 226 3 sdh2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q55CC2 3.04e-34 127 34 5 240 3 sdhB Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Dictyostelium discoideum
P21801 7.77e-34 125 34 6 234 1 SDH2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P21914 1.28e-33 125 33 5 234 2 SdhB Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Drosophila melanogaster
Q75CI4 1.69e-33 124 35 6 230 3 SDH2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
B0BM36 5.35e-33 124 33 6 231 2 sdhb Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Xenopus tropicalis
Q3T189 8.85e-33 123 32 6 232 1 SDHB Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Bos taurus
P80477 1.56e-32 121 31 3 223 3 SDH2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit Porphyra purpurea
Q9CQA3 6.48e-32 121 32 6 231 1 Sdhb Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Mus musculus
A8WPF0 6.91e-32 121 32 6 232 3 sdhb-1 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Caenorhabditis briggsae
Q007T0 7.91e-32 120 32 6 231 1 SDHB Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Sus scrofa
Q09545 9.23e-32 121 32 6 232 2 sdhb-1 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Caenorhabditis elegans
P21912 1.36e-31 120 32 6 231 1 SDHB Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Homo sapiens
Q6H4G3 1.76e-31 120 34 7 231 1 SDH2-2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 2, mitochondrial Oryza sativa subsp. japonica
O44074 2.45e-31 119 32 5 231 1 SDHB Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Ascaris suum
Q9YHT2 3.04e-31 119 33 5 233 1 SDHB Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Gallus gallus
Q3B8J8 4.29e-31 119 32 6 231 2 sdhb Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Xenopus laevis
Q6FWS8 5.28e-31 118 31 6 236 3 SDH2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138)
Q9FJP9 6.83e-31 119 33 7 228 1 SDH2-3 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 3, mitochondrial Arabidopsis thaliana
D9PUX5 1.9e-30 120 30 5 223 1 tfrB Fumarate reductase (CoM/CoB) subunit B Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
O06914 3.77e-30 115 28 5 226 3 frdB Fumarate reductase iron-sulfur subunit Helicobacter pylori (strain ATCC 700392 / 26695)
P48933 4.32e-30 115 29 3 231 3 SDH2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit Cyanidium caldarium
P21913 4.86e-30 116 31 6 231 2 Sdhb Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Rattus norvegicus
Q57557 7.55e-30 119 33 6 215 3 MJ0092 Uncharacterized iron-sulfur protein MJ0092 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P17596 9.77e-30 114 29 5 220 1 frdB Fumarate reductase iron-sulfur subunit Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
A5PL98 1.1e-29 115 31 6 231 2 sdhb Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Danio rerio
Q9ZMP1 1.14e-29 114 29 6 231 3 frdB Fumarate reductase iron-sulfur subunit Helicobacter pylori (strain J99 / ATCC 700824)
P48932 3.59e-29 113 30 3 223 3 SDH2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit Chondrus crispus
P08066 3.74e-27 107 25 5 234 3 sdhB Succinate dehydrogenase iron-sulfur subunit Bacillus subtilis (strain 168)
Q6LYC4 3.46e-26 109 32 5 197 3 MMP1067 Uncharacterized iron-sulfur protein MMP1067 Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
Q7M826 9.68e-25 102 33 4 207 1 sdhB 8-methylmenaquinol:fumarate reductase iron-sulfur subunit Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS11265
Feature type CDS
Gene -
Product succinate dehydrogenase/fumarate reductase iron-sulfur subunit
Location 392561 - 393295 (strand: -1)
Length 735 (nucleotides) / 244 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000002
Length 573139 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_849
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF13085 2Fe-2S iron-sulfur cluster binding domain
PF13237 4Fe-4S dicluster domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0479 Energy production and conversion (C) C Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit

Kegg Ortholog Annotation(s)

Protein Sequence

MAEMKMLKMSVMRYNPETDSEPHNVTYQVPYDEQTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNKVPKLACKTFLREYPEGMQIDALGNFPVERDLVVDMTHFIESLEAIKPYILGNDRKPSEGPNNQTPAQMAKYHQFSGCINCGLCYSACPQFGLNPEFLGPGVLALAQRYNTDSRDHGKKERMAQINGDNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVASAEDFIIARLKPQ

Flanking regions ( +/- flanking 50bp)

CGGCGAAGCTGCTGCGGCTGAACAGGCGAATAAAGAGAAGGAAAACGTCAATGGCTGAGATGAAAATGCTGAAAATGTCCGTGATGCGCTATAACCCGGAAACGGATAGTGAGCCGCATAATGTGACGTATCAGGTGCCTTACGATGAGCAGACTTCACTGCTTGATGCGCTGGGCTATATCAAAGATAACCTGGCTCCTGACCTCTCATACCGCTGGTCATGCCGCATGGCTATCTGCGGCTCGTGCGGCATGATGGTCAATAAAGTGCCGAAACTCGCCTGCAAAACGTTCCTGCGCGAATATCCGGAAGGCATGCAGATTGATGCTCTGGGGAATTTCCCGGTCGAGCGCGATCTGGTGGTCGATATGACACACTTTATTGAGAGTCTGGAAGCGATTAAGCCCTATATTCTCGGCAATGATCGCAAGCCGTCCGAAGGACCGAATAATCAGACACCGGCACAGATGGCGAAATACCATCAGTTCTCAGGCTGTATTAACTGTGGTCTGTGCTACTCCGCCTGTCCGCAGTTCGGGCTGAACCCGGAATTTCTCGGACCGGGTGTCCTGGCACTTGCTCAACGTTACAACACTGACAGCCGTGATCACGGTAAAAAAGAGCGCATGGCGCAAATCAATGGTGATAACGGGGTGTGGAGCTGTACATTCGTGGGCTACTGCTCTGAAGTTTGTCCGAAACATGTGGATCCGGCGGCGGCAATTCAGCAGGGGAAAGTCGCCAGTGCGGAAGACTTTATTATTGCCCGTCTGAAACCACAATAAGGAAGAGAGAAATGACGACCAAACGTAAACCTTATGTGCGTGAAATGACA