Homologs in group_64

Help

12 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08900 FBDBKF_08900 37.8 Morganella morganii S1 - Integrase catalytic domain-containing protein
FBDBKF_16590 FBDBKF_16590 35.0 Morganella morganii S1 - IS3 family transposase
FBDBKF_17970 FBDBKF_17970 100.0 Morganella morganii S1 - Integrase core domain
EHELCC_06365 EHELCC_06365 100.0 Morganella morganii S2 - Integrase core domain
EHELCC_12625 EHELCC_12625 37.8 Morganella morganii S2 - Integrase catalytic domain-containing protein
NLDBIP_12965 NLDBIP_12965 37.8 Morganella morganii S4 - Integrase catalytic domain-containing protein
LHKJJB_13590 LHKJJB_13590 37.8 Morganella morganii S3 - Integrase catalytic domain-containing protein
LHKJJB_19285 LHKJJB_19285 100.0 Morganella morganii S3 - Integrase core domain
HKOGLL_04705 HKOGLL_04705 100.0 Morganella morganii S5 - Integrase core domain
HKOGLL_11440 HKOGLL_11440 37.8 Morganella morganii S5 - Integrase catalytic domain-containing protein
F4V73_RS01605 F4V73_RS01605 45.8 Morganella psychrotolerans - IS3 family transposase
PMI_RS15560 PMI_RS15560 22.1 Proteus mirabilis HI4320 - IS481 family transposase

Distribution of the homologs in the orthogroup group_64

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_64

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P24577 3.15e-18 80 41 1 101 4 Bmul_4719 Insertion element IS407 uncharacterized 31.7 kDa protein Burkholderia multivorans (strain ATCC 17616 / 249)
P25438 1.56e-17 79 36 1 101 4 None Insertion element IS476 uncharacterized 39.2 kDa protein Xanthomonas euvesicatoria

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_06685
Feature type CDS
Gene -
Product Integrase core domain
Location 2458 - 2814 (strand: -1)
Length 357 (nucleotides) / 118 (amino acids)
In genomic island GI4

Contig

Accession ZDB_522
Length 269640 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_64
Orthogroup size 13
N. genomes 7

Actions

Genomic region

Domains

PF00665 Integrase core domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2801 Mobilome: prophages, transposons (X) X Transposase InsO and inactivated derivatives

Protein Sequence

MRKACFTEHQIIAVIKSVETGRTVKVDDFNRETLSIKIILNLPDLRMIRVLDRIAANCGYPIMLHMNNGPEFISLILAEWAEKHAVKRDLIQPGKPTQDTFIEYFNRTYRTYAIFIYS

Flanking regions ( +/- flanking 50bp)

TGACGGTGTAAGTATCCCGCATAATTAATTTGCCAACGAAGGAGATCGCTATGCGTAAAGCCTGTTTTACTGAGCATCAGATCATCGCCGTAATTAAGTCGGTTGAAACCGGGCGGACTGTTAAAGTTGATGACTTTAACCGTGAGACATTGTCGATTAAAATCATTCTGAATCTGCCAGATCTGCGAATGATCCGTGTACTCGACAGGATCGCGGCAAACTGCGGCTACCCGATCATGCTGCACATGAATAATGGTCCAGAATTTATCTCACTGATACTGGCTGAATGGGCAGAAAAACATGCAGTAAAACGGGATCTTATCCAGCCAGGTAAGCCGACGCAGGACACTTTCATTGAATACTTTAACCGGACATACCGTACATACGCGATTTTTATATATTCATGATCAGACGTGAGATAAATAACGAATTGGAGTGGGTTTAAACAGGTTATAAC