Homologs in group_3511

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_06365 EHELCC_06365 100.0 Morganella morganii S2 - Integrase core domain
NLDBIP_06685 NLDBIP_06685 100.0 Morganella morganii S4 - Integrase core domain
LHKJJB_19285 LHKJJB_19285 100.0 Morganella morganii S3 - Integrase core domain
HKOGLL_04705 HKOGLL_04705 100.0 Morganella morganii S5 - Integrase core domain

Distribution of the homologs in the orthogroup group_3511

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3511

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P24577 3.15e-18 80 41 1 101 4 Bmul_4719 Insertion element IS407 uncharacterized 31.7 kDa protein Burkholderia multivorans (strain ATCC 17616 / 249)
P25438 1.56e-17 79 36 1 101 4 None Insertion element IS476 uncharacterized 39.2 kDa protein Xanthomonas euvesicatoria

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_17970
Feature type CDS
Gene -
Product Integrase core domain
Location 33435 - 33791 (strand: 1)
Length 357 (nucleotides) / 118 (amino acids)

Contig

Accession contig_31
Length 36259 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3511
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Domains

PF00665 Integrase core domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2801 Mobilome: prophages, transposons (X) X Transposase InsO and inactivated derivatives

Protein Sequence

MRKACFTEHQIIAVIKSVETGRTVKVDDFNRETLSIKIILNLPDLRMIRVLDRIAANCGYPIMLHMNNGPEFISLILAEWAEKHAVKRDLIQPGKPTQDTFIEYFNRTYRTYAIFIYS

Flanking regions ( +/- flanking 50bp)

TGACGGTGTAAGTATCCCGCATAATTAATTTGCCAACGAAGGAGATCGCTATGCGTAAAGCCTGTTTTACTGAGCATCAGATCATCGCCGTAATTAAGTCGGTTGAAACCGGGCGGACTGTTAAAGTTGATGACTTTAACCGTGAGACATTGTCGATTAAAATCATTCTGAATCTGCCAGATCTGCGAATGATCCGTGTACTCGACAGGATCGCGGCAAACTGCGGCTACCCGATCATGCTGCACATGAATAATGGTCCAGAATTTATCTCACTGATACTGGCTGAATGGGCAGAAAAACATGCAGTAAAACGGGATCTTATCCAGCCAGGTAAGCCGACGCAGGACACTTTCATTGAATACTTTAACCGGACATACCGTACATACGCGATTTTTATATATTCATGATCAGACGTGAGATAAATAACGAATTGGAGTGGGTTTAAACAGGTTATAAC