Homologs in group_1788

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_12180 FBDBKF_12180 100.0 Morganella morganii S1 metF methylenetetrahydrofolate reductase
EHELCC_14125 EHELCC_14125 100.0 Morganella morganii S2 metF methylenetetrahydrofolate reductase
NLDBIP_15220 NLDBIP_15220 100.0 Morganella morganii S4 metF methylenetetrahydrofolate reductase
HKOGLL_14510 HKOGLL_14510 100.0 Morganella morganii S5 metF methylenetetrahydrofolate reductase
F4V73_RS16990 F4V73_RS16990 96.0 Morganella psychrotolerans metF methylenetetrahydrofolate reductase
PMI_RS14495 PMI_RS14495 79.2 Proteus mirabilis HI4320 metF methylenetetrahydrofolate reductase

Distribution of the homologs in the orthogroup group_1788

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1788

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P11003 0.0 517 80 0 295 3 metF 5,10-methylenetetrahydrofolate reductase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P71319 0.0 513 80 0 294 3 metF 5,10-methylenetetrahydrofolate reductase Pectobacterium carotovorum subsp. carotovorum
P0AEZ2 0.0 506 78 0 295 3 metF 5,10-methylenetetrahydrofolate reductase Shigella flexneri
P0AEZ1 0.0 506 78 0 295 1 metF 5,10-methylenetetrahydrofolate reductase Escherichia coli (strain K12)
P45208 1.53e-156 441 71 0 285 1 metF 5,10-methylenetetrahydrofolate reductase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9JZQ3 2.69e-153 433 71 0 284 1 metF 5,10-methylenetetrahydrofolate reductase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q89B13 7.02e-128 369 54 1 291 3 metF 5,10-methylenetetrahydrofolate reductase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P57154 8.05e-128 369 57 0 285 3 metF 5,10-methylenetetrahydrofolate reductase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q8KA62 3.55e-123 357 56 0 292 3 metF 5,10-methylenetetrahydrofolate reductase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
O67422 7.78e-75 234 44 4 276 3 metF 5,10-methylenetetrahydrofolate reductase Aquifex aeolicus (strain VF5)
O54235 5.25e-64 206 40 2 279 1 metF 5,10-methylenetetrahydrofolate reductase Streptomyces lividans
Q9SE60 1.29e-50 179 35 3 289 1 MTHFR1 Methylenetetrahydrofolate reductase (NADH) 1 Arabidopsis thaliana
O80585 1.65e-50 178 35 4 296 1 MTHFR2 Methylenetetrahydrofolate reductase (NADH) 2 Arabidopsis thaliana
Q75HE6 7.74e-48 171 33 4 293 2 Os03g0815200 Probable methylenetetrahydrofolate reductase (NADH) Oryza sativa subsp. japonica
Q9SE94 5.37e-47 169 32 3 289 1 None Methylenetetrahydrofolate reductase (NADH) 1 Zea mays
P53128 2.32e-39 148 31 7 299 1 MET13 Methylenetetrahydrofolate reductase 2 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P42898 3.78e-39 148 32 8 302 1 MTHFR Methylenetetrahydrofolate reductase (NADPH) Homo sapiens
Q5I598 6.41e-39 147 32 7 284 2 MTHFR Methylenetetrahydrofolate reductase (NADPH) Bos taurus
Q9WU20 1.25e-38 147 32 7 302 1 Mthfr Methylenetetrahydrofolate reductase (NADPH) Mus musculus
Q10258 2.52e-38 145 31 3 279 1 met9 Methylenetetrahydrofolate reductase 1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q60HE5 2.69e-38 146 32 8 302 2 MTHFR Methylenetetrahydrofolate reductase (NADPH) Macaca fascicularis
P46151 3.83e-37 142 31 9 294 1 MET12 Methylenetetrahydrofolate reductase 1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q17693 1.19e-34 135 31 6 279 3 mthf-1 Probable methylenetetrahydrofolate reductase (NADPH) Caenorhabditis elegans
O74927 1.91e-21 97 31 10 283 2 met11 Methylenetetrahydrofolate reductase 2 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
G2IQS8 7.98e-05 47 28 10 189 1 metF 5,10-methylenetetrahydrofolate reductase Sphingobium sp. (strain NBRC 103272 / SYK-6)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_15390
Feature type CDS
Gene metF
Product methylenetetrahydrofolate reductase
Location 92823 - 93722 (strand: 1)
Length 900 (nucleotides) / 299 (amino acids)
In genomic island -

Contig

Accession ZDB_373
Length 137108 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1788
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02219 Methylenetetrahydrofolate reductase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0685 Amino acid transport and metabolism (E) E 5,10-methylenetetrahydrofolate reductase

Kegg Ortholog Annotation(s)

Protein Sequence

MSFLHIDQHEALNQNLAELAGRVAVSFEFFPPGTPEMEKTLWQSIERLSVLKPKFVSVTYGANSGERDRTHSVIKSIKEKTGLIAVPHLTCIDATRDELKTIARDYWDNGIRHIVALRGDLPDSSSKPDMYAADLVGLLKSVADFDISVAAYPEVHPEARSAQSDLINLKKKIDAGADRAITQFFFDVSTYLRFRDRCAAAGIDVEIVPGILPVSNFRQLQRFAGMTNVRIPGWLGTMFEGLDDDPESRKLVGASVAMEMVKLLSREGVKDFHFYTLNRAELTYAICHTLGVRPAACVA

Flanking regions ( +/- flanking 50bp)

AATAATCACGTGCCGGGATATATCCGCCACGGACGACCGCGGGGGCAGCGATGAGTTTTTTACATATAGACCAGCACGAAGCACTGAATCAGAACCTGGCAGAACTGGCCGGTCGTGTGGCCGTATCCTTTGAATTTTTCCCGCCGGGCACGCCGGAAATGGAAAAAACCCTGTGGCAGTCCATCGAACGCCTCAGTGTGCTGAAACCAAAATTTGTCTCCGTCACTTACGGGGCGAACTCCGGCGAGCGGGACCGCACCCATTCGGTGATTAAAAGTATCAAAGAGAAAACCGGGCTGATTGCTGTTCCGCACCTGACCTGTATTGATGCCACCCGTGATGAGCTGAAAACTATCGCCAGAGATTACTGGGATAACGGTATCCGCCATATTGTGGCGCTGCGCGGCGACCTGCCGGACAGCAGCAGCAAACCGGATATGTATGCCGCTGACCTGGTCGGTTTGTTAAAATCGGTCGCCGATTTTGATATTTCCGTCGCCGCTTACCCGGAAGTGCATCCGGAAGCACGCAGTGCACAGTCAGATCTGATTAACCTGAAAAAGAAAATAGATGCCGGTGCAGATCGCGCTATCACGCAGTTTTTCTTTGATGTCAGCACCTATCTGCGTTTCCGTGACCGCTGCGCGGCGGCGGGGATTGATGTGGAGATTGTGCCGGGTATTCTGCCGGTCTCTAACTTCAGGCAGTTACAGCGCTTTGCAGGAATGACTAATGTCCGCATCCCGGGCTGGCTCGGCACCATGTTTGAAGGGCTGGATGATGACCCGGAATCCCGCAAGCTGGTCGGGGCTTCCGTAGCAATGGAGATGGTGAAACTGCTCAGCCGTGAAGGCGTAAAAGATTTCCACTTCTACACCCTGAACCGTGCGGAACTGACTTACGCTATCTGCCATACCCTGGGTGTCCGCCCGGCCGCCTGCGTGGCATAAAAGATAACGATATCATTGAGTAATCAGTGATATCGTTTAATTATTTTGTA