Homologs in group_1237

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06790 FBDBKF_06790 100.0 Morganella morganii S1 folE GTP cyclohydrolase I FolE
EHELCC_04180 EHELCC_04180 100.0 Morganella morganii S2 folE GTP cyclohydrolase I FolE
NLDBIP_04180 NLDBIP_04180 100.0 Morganella morganii S4 folE GTP cyclohydrolase I FolE
HKOGLL_08965 HKOGLL_08965 100.0 Morganella morganii S5 folE GTP cyclohydrolase I FolE
F4V73_RS00930 F4V73_RS00930 98.2 Morganella psychrotolerans folE GTP cyclohydrolase I FolE
PMI_RS03150 PMI_RS03150 89.0 Proteus mirabilis HI4320 folE GTP cyclohydrolase I FolE

Distribution of the homologs in the orthogroup group_1237

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1237

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A1JU09 1.7e-141 397 90 0 218 3 folE GTP cyclohydrolase 1 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B1JQJ4 1.27e-139 392 90 0 218 3 folE GTP cyclohydrolase 1 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A9R1B1 1.27e-139 392 90 0 218 3 folE GTP cyclohydrolase 1 Yersinia pestis bv. Antiqua (strain Angola)
Q8ZG15 1.27e-139 392 90 0 218 1 folE GTP cyclohydrolase 1 Yersinia pestis
B2JZ02 1.27e-139 392 90 0 218 3 folE GTP cyclohydrolase 1 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FJL1 1.27e-139 392 90 0 218 3 folE GTP cyclohydrolase 1 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q7N6K7 6.77e-135 380 89 0 219 3 folE GTP cyclohydrolase 1 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
C5BCL9 1.02e-134 380 87 0 218 3 folE GTP cyclohydrolase 1 Edwardsiella ictaluri (strain 93-146)
A8GC24 1.22e-134 379 88 0 218 3 folE GTP cyclohydrolase 1 Serratia proteamaculans (strain 568)
A8AE79 9.91e-133 375 87 2 224 3 folE GTP cyclohydrolase 1 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B5XP57 2.28e-132 374 87 1 220 3 folE GTP cyclohydrolase 1 Klebsiella pneumoniae (strain 342)
A6TBN8 2.38e-132 374 87 1 220 3 folE GTP cyclohydrolase 1 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A4WCI8 7.21e-132 372 87 1 220 3 folE GTP cyclohydrolase 1 Enterobacter sp. (strain 638)
Q3Z053 1.15e-131 372 86 2 224 3 folE GTP cyclohydrolase 1 Shigella sonnei (strain Ss046)
P0A6T8 1.15e-131 372 86 2 224 3 folE GTP cyclohydrolase 1 Shigella flexneri
Q0T2X1 1.15e-131 372 86 2 224 3 folE GTP cyclohydrolase 1 Shigella flexneri serotype 5b (strain 8401)
Q32EN8 1.15e-131 372 86 2 224 3 folE GTP cyclohydrolase 1 Shigella dysenteriae serotype 1 (strain Sd197)
Q31YW1 1.15e-131 372 86 2 224 3 folE GTP cyclohydrolase 1 Shigella boydii serotype 4 (strain Sb227)
B2TVT9 1.15e-131 372 86 2 224 3 folE GTP cyclohydrolase 1 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LVB3 1.15e-131 372 86 2 224 3 folE GTP cyclohydrolase 1 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R9R9 1.15e-131 372 86 2 224 3 folE GTP cyclohydrolase 1 Escherichia coli (strain UTI89 / UPEC)
B1LKQ0 1.15e-131 372 86 2 224 3 folE GTP cyclohydrolase 1 Escherichia coli (strain SMS-3-5 / SECEC)
B6I8K3 1.15e-131 372 86 2 224 3 folE GTP cyclohydrolase 1 Escherichia coli (strain SE11)
B7NCI3 1.15e-131 372 86 2 224 3 folE GTP cyclohydrolase 1 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A6T5 1.15e-131 372 86 2 224 1 folE GTP cyclohydrolase 1 Escherichia coli (strain K12)
B1IYB6 1.15e-131 372 86 2 224 3 folE GTP cyclohydrolase 1 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A6T6 1.15e-131 372 86 2 224 3 folE GTP cyclohydrolase 1 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TFT7 1.15e-131 372 86 2 224 3 folE GTP cyclohydrolase 1 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AD13 1.15e-131 372 86 2 224 3 folE GTP cyclohydrolase 1 Escherichia coli O1:K1 / APEC
A8A214 1.15e-131 372 86 2 224 3 folE GTP cyclohydrolase 1 Escherichia coli O9:H4 (strain HS)
B1X7P1 1.15e-131 372 86 2 224 3 folE GTP cyclohydrolase 1 Escherichia coli (strain K12 / DH10B)
C4ZU03 1.15e-131 372 86 2 224 3 folE GTP cyclohydrolase 1 Escherichia coli (strain K12 / MC4100 / BW2952)
B7M4Z9 1.15e-131 372 86 2 224 3 folE GTP cyclohydrolase 1 Escherichia coli O8 (strain IAI1)
B7MXG6 1.15e-131 372 86 2 224 3 folE GTP cyclohydrolase 1 Escherichia coli O81 (strain ED1a)
B7NMB8 1.15e-131 372 86 2 224 3 folE GTP cyclohydrolase 1 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YWU3 1.15e-131 372 86 2 224 3 folE GTP cyclohydrolase 1 Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A6T7 1.15e-131 372 86 2 224 3 folE GTP cyclohydrolase 1 Escherichia coli O157:H7
B7LAH4 1.15e-131 372 86 2 224 3 folE GTP cyclohydrolase 1 Escherichia coli (strain 55989 / EAEC)
B7MF66 1.15e-131 372 86 2 224 3 folE GTP cyclohydrolase 1 Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UFG9 1.15e-131 372 86 2 224 3 folE GTP cyclohydrolase 1 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZNX6 1.15e-131 372 86 2 224 3 folE GTP cyclohydrolase 1 Escherichia coli O139:H28 (strain E24377A / ETEC)
P64209 1.39e-131 372 86 2 224 3 folE GTP cyclohydrolase 1 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P64210 1.39e-131 372 86 2 224 3 folE GTP cyclohydrolase 1 Salmonella typhi
B4TNQ0 1.39e-131 372 86 2 224 3 folE GTP cyclohydrolase 1 Salmonella schwarzengrund (strain CVM19633)
B5BE43 1.39e-131 372 86 2 224 3 folE GTP cyclohydrolase 1 Salmonella paratyphi A (strain AKU_12601)
C0Q0U7 1.39e-131 372 86 2 224 3 folE GTP cyclohydrolase 1 Salmonella paratyphi C (strain RKS4594)
A9N6K0 1.39e-131 372 86 2 224 3 folE GTP cyclohydrolase 1 Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PE52 1.39e-131 372 86 2 224 3 folE GTP cyclohydrolase 1 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SY26 1.39e-131 372 86 2 224 3 folE GTP cyclohydrolase 1 Salmonella newport (strain SL254)
B4TAL5 1.39e-131 372 86 2 224 3 folE GTP cyclohydrolase 1 Salmonella heidelberg (strain SL476)
B5R163 1.39e-131 372 86 2 224 3 folE GTP cyclohydrolase 1 Salmonella enteritidis PT4 (strain P125109)
B5FNJ7 1.39e-131 372 86 2 224 3 folE GTP cyclohydrolase 1 Salmonella dublin (strain CT_02021853)
A9MK63 1.39e-131 372 86 2 224 3 folE GTP cyclohydrolase 1 Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5EYP3 1.39e-131 372 86 2 224 3 folE GTP cyclohydrolase 1 Salmonella agona (strain SL483)
Q2NUE3 1.52e-131 372 83 0 218 3 folE GTP cyclohydrolase 1 Sodalis glossinidius (strain morsitans)
Q6D3N3 2.92e-131 371 86 0 218 3 folE GTP cyclohydrolase 1 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B5RC32 3.9e-131 370 86 2 224 3 folE GTP cyclohydrolase 1 Salmonella gallinarum (strain 287/91 / NCTC 13346)
Q57ME6 4.96e-131 370 86 2 224 3 folE GTP cyclohydrolase 1 Salmonella choleraesuis (strain SC-B67)
B2VII2 2.25e-127 361 82 1 220 3 folE GTP cyclohydrolase 1 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
C6DEM6 3.04e-123 350 87 0 218 3 folE GTP cyclohydrolase 1 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
C4LDE6 1.1e-115 331 72 0 216 3 folE GTP cyclohydrolase 1 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
C4K3L4 7.2e-113 324 72 2 220 3 folE GTP cyclohydrolase 1 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q1LT77 1.86e-111 321 77 1 215 3 folE GTP cyclohydrolase 1 Baumannia cicadellinicola subsp. Homalodisca coagulata
Q9KLX5 1.14e-110 319 70 0 217 3 folE GTP cyclohydrolase 1 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A7N6L2 1.5e-110 318 70 0 217 3 folE GTP cyclohydrolase 1 Vibrio campbellii (strain ATCC BAA-1116)
Q7MDE5 1.08e-109 316 70 0 217 3 folE GTP cyclohydrolase 1 Vibrio vulnificus (strain YJ016)
Q8D6I7 1.08e-109 316 70 0 217 3 folE GTP cyclohydrolase 1 Vibrio vulnificus (strain CMCP6)
Q6LQL4 2.53e-109 315 70 0 217 3 folE GTP cyclohydrolase 1 Photobacterium profundum (strain SS9)
A0KIN6 9.4e-107 309 73 0 213 3 folE GTP cyclohydrolase 1 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A4SPE8 1.77e-106 308 73 0 213 3 folE GTP cyclohydrolase 1 Aeromonas salmonicida (strain A449)
Q0HE51 2.76e-105 305 70 0 215 3 folE GTP cyclohydrolase 1 Shewanella sp. (strain MR-4)
A0L1S4 2.76e-105 305 70 0 215 3 folE GTP cyclohydrolase 1 Shewanella sp. (strain ANA-3)
Q0HZU8 3.84e-105 305 70 0 215 3 folE GTP cyclohydrolase 1 Shewanella sp. (strain MR-7)
Q8E9L6 1.05e-104 303 70 0 214 3 folE GTP cyclohydrolase 1 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q12SG0 1.16e-104 303 71 0 215 3 folE GTP cyclohydrolase 1 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A1REU0 2.57e-104 302 71 0 211 3 folE GTP cyclohydrolase 1 Shewanella sp. (strain W3-18-1)
A4Y2K7 2.57e-104 302 71 0 211 3 folE GTP cyclohydrolase 1 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A9KXZ9 3.01e-104 302 69 0 215 3 folE GTP cyclohydrolase 1 Shewanella baltica (strain OS195)
A6WIA1 3.01e-104 302 69 0 215 3 folE GTP cyclohydrolase 1 Shewanella baltica (strain OS185)
A3CZJ1 3.01e-104 302 69 0 215 3 folE GTP cyclohydrolase 1 Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8E4J0 3.01e-104 302 69 0 215 3 folE GTP cyclohydrolase 1 Shewanella baltica (strain OS223)
A1S2C7 3.25e-104 302 71 0 215 3 folE GTP cyclohydrolase 1 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A3QIQ4 2.32e-103 300 71 0 211 3 folE GTP cyclohydrolase 1 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q7VRX3 7.26e-103 299 64 0 213 3 folE GTP cyclohydrolase 1 Blochmanniella floridana
Q87GZ6 8.29e-102 296 70 0 217 3 folE GTP cyclohydrolase 1 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q492J7 1.66e-101 296 67 0 215 3 folE GTP cyclohydrolase 1 Blochmanniella pennsylvanica (strain BPEN)
P57865 7.28e-99 289 64 0 213 3 folE GTP cyclohydrolase 1 Pasteurella multocida (strain Pm70)
Q65TR0 1.18e-98 288 64 0 213 3 folE GTP cyclohydrolase 1 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q7VM90 1.91e-98 288 63 0 213 3 folE GTP cyclohydrolase 1 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B0UUA9 3.19e-98 287 63 0 213 3 folE GTP cyclohydrolase 1 Histophilus somni (strain 2336)
Q0I3F6 3.19e-98 287 63 0 213 3 folE GTP cyclohydrolase 1 Histophilus somni (strain 129Pt)
B0BPI8 4.19e-98 287 63 0 213 3 folE GTP cyclohydrolase 1 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GXP9 4.19e-98 287 63 0 213 3 folE GTP cyclohydrolase 1 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N0R3 4.19e-98 287 63 0 213 3 folE GTP cyclohydrolase 1 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
A5UC59 5.7e-98 286 63 0 213 3 folE GTP cyclohydrolase 1 Haemophilus influenzae (strain PittEE)
Q4QKH4 5.7e-98 286 63 0 213 3 folE GTP cyclohydrolase 1 Haemophilus influenzae (strain 86-028NP)
P43866 9.96e-98 286 63 0 213 3 folE GTP cyclohydrolase 1 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UEW4 2.61e-97 285 63 0 213 3 folE GTP cyclohydrolase 1 Haemophilus influenzae (strain PittGG)
B5FF36 1.04e-94 278 71 0 217 3 folE GTP cyclohydrolase 1 Aliivibrio fischeri (strain MJ11)
Q5E4E4 1.04e-94 278 71 0 217 3 folE GTP cyclohydrolase 1 Aliivibrio fischeri (strain ATCC 700601 / ES114)
B6EGN8 2.81e-94 277 71 0 217 3 folE GTP cyclohydrolase 1 Aliivibrio salmonicida (strain LFI1238)
Q8KA05 4.25e-86 256 57 1 215 3 folE GTP cyclohydrolase 1 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q8D2N7 2.4e-81 244 58 2 216 3 folE GTP cyclohydrolase 1 Wigglesworthia glossinidia brevipalpis
A5FHM7 1.02e-60 192 49 2 195 3 folE GTP cyclohydrolase 1 Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
B2V9P4 2.64e-43 147 45 2 179 3 folE GTP cyclohydrolase 1 Sulfurihydrogenibium sp. (strain YO3AOP1)
C0QPU5 8.63e-40 137 45 3 162 3 folE GTP cyclohydrolase 1 Persephonella marina (strain DSM 14350 / EX-H1)
Q8DZI5 1.09e-39 137 42 4 180 3 folE GTP cyclohydrolase 1 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8YN49 1.33e-39 138 40 3 194 3 folE2 GTP cyclohydrolase 1 2 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q3K0Y1 1.87e-39 137 42 4 180 3 folE GTP cyclohydrolase 1 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q3ADI2 1.87e-39 137 43 4 182 3 folE GTP cyclohydrolase 1 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q3ATN0 2.12e-39 138 42 3 181 3 folE GTP cyclohydrolase 1 Chlorobium chlorochromatii (strain CaD3)
Q5N623 3.57e-39 137 39 5 205 3 folE GTP cyclohydrolase 1 Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q54769 3.57e-39 137 39 5 205 3 folE GTP cyclohydrolase 1 Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q5M391 4.16e-39 136 41 3 182 3 folE GTP cyclohydrolase 1 Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LYM8 4.16e-39 136 41 3 182 3 folE GTP cyclohydrolase 1 Streptococcus thermophilus (strain CNRZ 1066)
Q607T5 5.49e-39 135 41 2 178 3 folE GTP cyclohydrolase 1 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q7NK98 6.5e-39 136 44 3 177 3 folE GTP cyclohydrolase 1 Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
A4VVH1 9.05e-39 135 42 3 182 3 folE GTP cyclohydrolase 1 Streptococcus suis (strain 05ZYH33)
A4W1S9 9.05e-39 135 42 3 182 3 folE GTP cyclohydrolase 1 Streptococcus suis (strain 98HAH33)
Q8KEA8 1.04e-38 136 44 2 172 3 folE GTP cyclohydrolase 1 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q8E549 1.08e-38 135 41 4 180 3 folE GTP cyclohydrolase 1 Streptococcus agalactiae serotype III (strain NEM316)
A3CKF4 1.08e-38 135 38 3 186 3 folE GTP cyclohydrolase 1 Streptococcus sanguinis (strain SK36)
Q7UJJ7 1.11e-38 136 39 2 177 3 folE GTP cyclohydrolase 1 Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
A1TG42 1.4e-38 135 43 3 181 3 folE GTP cyclohydrolase 1 Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
A4T5P2 1.54e-38 135 42 3 185 3 folE GTP cyclohydrolase 1 Mycolicibacterium gilvum (strain PYR-GCK)
Q82Z12 1.83e-38 134 41 4 187 3 folE GTP cyclohydrolase 1 Enterococcus faecalis (strain ATCC 700802 / V583)
Q2JR69 2.08e-38 135 53 0 124 3 folE GTP cyclohydrolase 1 Synechococcus sp. (strain JA-3-3Ab)
P9WN57 2.13e-38 134 45 5 180 1 folE GTP cyclohydrolase 1 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WN56 2.13e-38 134 45 5 180 3 folE GTP cyclohydrolase 1 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U8T4 2.13e-38 134 45 5 180 3 folE GTP cyclohydrolase 1 Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AI67 2.13e-38 134 45 5 180 3 folE GTP cyclohydrolase 1 Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KPU4 2.13e-38 134 45 5 180 3 folE GTP cyclohydrolase 1 Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P64208 2.13e-38 134 45 5 180 3 folE GTP cyclohydrolase 1 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q8DJB8 2.21e-38 135 44 4 176 3 folE GTP cyclohydrolase 1 Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q056J8 3.02e-38 134 43 4 184 3 folE GTP cyclohydrolase 1 Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04P36 3.02e-38 134 43 4 184 3 folE GTP cyclohydrolase 1 Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
A4J5D0 3.45e-38 134 40 4 180 3 folE GTP cyclohydrolase 1 Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
Q8DUG2 3.9e-38 134 42 3 183 3 folE GTP cyclohydrolase 1 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
P19465 4.77e-38 133 41 4 185 1 folE GTP cyclohydrolase 1 Bacillus subtilis (strain 168)
A4SF37 5.47e-38 134 39 3 212 3 folE GTP cyclohydrolase 1 Chlorobium phaeovibrioides (strain DSM 265 / 1930)
A8FJZ5 8.37e-38 132 42 3 172 3 folE GTP cyclohydrolase 1 Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q5HWX4 8.46e-38 132 43 3 172 3 folE GTP cyclohydrolase 1 Campylobacter jejuni (strain RM1221)
Q2JPT8 9.88e-38 134 52 0 124 3 folE GTP cyclohydrolase 1 Synechococcus sp. (strain JA-2-3B'a(2-13))
Q743Z2 1.35e-37 132 42 5 184 3 folE GTP cyclohydrolase 1 Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q8FMG3 1.44e-37 132 43 5 180 3 folE GTP cyclohydrolase 1 Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
A5VQL0 1.52e-37 132 41 3 182 3 folE GTP cyclohydrolase 1 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
A6LFE8 1.59e-37 132 40 3 182 3 folE GTP cyclohydrolase 1 Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
A5D2D8 1.78e-37 132 43 4 179 3 folE GTP cyclohydrolase 1 Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
P0C0C1 1.95e-37 132 41 3 180 3 folE GTP cyclohydrolase 1 Streptococcus pyogenes
B2HJ53 2.29e-37 132 43 5 180 3 folE GTP cyclohydrolase 1 Mycobacterium marinum (strain ATCC BAA-535 / M)
B9KDZ8 2.41e-37 131 40 2 179 3 folE GTP cyclohydrolase 1 Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
P51594 2.52e-37 131 41 3 172 3 folE GTP cyclohydrolase 1 Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A0PV57 2.52e-37 132 43 5 180 3 folE GTP cyclohydrolase 1 Mycobacterium ulcerans (strain Agy99)
Q8G0L4 2.75e-37 132 41 3 182 3 folE GTP cyclohydrolase 1 Brucella suis biovar 1 (strain 1330)
A9M586 2.75e-37 132 41 3 182 3 folE GTP cyclohydrolase 1 Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
A7Z630 2.83e-37 131 40 4 185 3 folE GTP cyclohydrolase 1 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
A1VXS2 3.22e-37 131 41 3 172 3 folE GTP cyclohydrolase 1 Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q8YH94 3.37e-37 132 41 3 182 3 folE GTP cyclohydrolase 1 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RJ47 3.37e-37 132 41 3 182 3 folE GTP cyclohydrolase 1 Brucella melitensis biotype 2 (strain ATCC 23457)
Q57D61 3.37e-37 132 41 3 182 3 folE GTP cyclohydrolase 1 Brucella abortus biovar 1 (strain 9-941)
Q2YQ03 3.37e-37 132 41 3 182 3 folE GTP cyclohydrolase 1 Brucella abortus (strain 2308)
B2S5T0 3.37e-37 132 41 3 182 3 folE GTP cyclohydrolase 1 Brucella abortus (strain S19)
P0A3E9 4.06e-37 131 41 3 180 3 folE GTP cyclohydrolase 1 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XCA9 4.06e-37 131 41 3 180 3 folE GTP cyclohydrolase 1 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0C0C2 4.06e-37 131 41 3 180 3 folE GTP cyclohydrolase 1 Streptococcus pyogenes serotype M1
Q98LQ6 4.19e-37 131 39 2 184 3 folE GTP cyclohydrolase 1 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q8EYG1 4.54e-37 130 42 3 184 3 folE GTP cyclohydrolase 1 Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72LY8 4.54e-37 130 42 3 184 3 folE GTP cyclohydrolase 1 Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
B1HTA3 5.21e-37 130 39 4 181 3 folE GTP cyclohydrolase 1 Lysinibacillus sphaericus (strain C3-41)
B1MGU9 5.91e-37 131 43 4 183 3 folE GTP cyclohydrolase 1 Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
P0DB31 6.06e-37 130 41 3 180 3 folE GTP cyclohydrolase 1 Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DB30 6.06e-37 130 41 3 180 3 folE GTP cyclohydrolase 1 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
A0QA85 6.1e-37 131 42 5 184 3 folE GTP cyclohydrolase 1 Mycobacterium avium (strain 104)
Q9HYG8 6.33e-37 130 42 3 184 3 folE1 GTP cyclohydrolase 1 1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B0CGM4 6.43e-37 131 41 3 182 3 folE GTP cyclohydrolase 1 Brucella suis (strain ATCC 23445 / NCTC 10510)
Q8YLL1 6.89e-37 132 40 3 180 3 folE1 GTP cyclohydrolase 1 1 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
B0SRX6 7.38e-37 130 43 3 182 3 folE GTP cyclohydrolase 1 Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0S8X8 7.38e-37 130 43 3 182 3 folE GTP cyclohydrolase 1 Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
Q0A939 7.81e-37 130 39 3 191 3 folE GTP cyclohydrolase 1 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q5KXT7 7.88e-37 130 40 4 187 3 folE GTP cyclohydrolase 1 Geobacillus kaustophilus (strain HTA426)
A2REL9 8.28e-37 130 41 3 180 3 folE GTP cyclohydrolase 1 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q8R7N2 8.87e-37 130 38 3 180 3 folE GTP cyclohydrolase 1 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
B5YJV0 1.04e-36 130 38 2 177 3 folE GTP cyclohydrolase 1 Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
C1DHG2 1.13e-36 129 39 3 186 3 folE GTP cyclohydrolase 1 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q7M933 1.8e-36 129 35 3 189 3 folE GTP cyclohydrolase 1 Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q884Q3 2.31e-36 129 39 2 186 3 folE2 GTP cyclohydrolase 1 2 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q55759 3.74e-36 130 40 4 195 3 folE GTP cyclohydrolase 1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8P3B0 4.1e-36 129 36 3 183 3 folE GTP cyclohydrolase 1 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q2IY20 4.39e-36 129 36 3 191 3 folE GTP cyclohydrolase 1 Rhodopseudomonas palustris (strain HaA2)
B5XLE8 4.45e-36 128 40 3 180 3 folE GTP cyclohydrolase 1 Streptococcus pyogenes serotype M49 (strain NZ131)
A7H1R1 5.21e-36 128 41 3 172 3 folE GTP cyclohydrolase 1 Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
A8AZD8 5.7e-36 128 40 3 176 3 folE GTP cyclohydrolase 1 Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
O13774 6.09e-36 129 40 3 185 1 SPAC17A5.13 GTP cyclohydrolase 1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q9I351 6.94e-36 127 38 3 190 3 folE2 GTP cyclohydrolase 1 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B8ZL26 7.89e-36 127 37 3 182 3 folE GTP cyclohydrolase 1 Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
Q887V1 8.31e-36 127 41 3 184 3 folE1 GTP cyclohydrolase 1 1 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
B3QE25 1.02e-35 128 36 3 190 3 folE GTP cyclohydrolase 1 Rhodopseudomonas palustris (strain TIE-1)
Q6N4E7 1.02e-35 128 36 3 190 3 folE GTP cyclohydrolase 1 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
P51595 1.1e-35 127 37 3 182 3 folE GTP cyclohydrolase 1 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
C1CB65 1.1e-35 127 37 3 182 3 folE GTP cyclohydrolase 1 Streptococcus pneumoniae (strain 70585)
B5E6W5 1.1e-35 127 37 3 182 3 folE GTP cyclohydrolase 1 Streptococcus pneumoniae serotype 19F (strain G54)
B0K5C1 1.22e-35 127 37 3 180 3 folE GTP cyclohydrolase 1 Thermoanaerobacter sp. (strain X514)
B0KCE5 1.22e-35 127 37 3 180 3 folE GTP cyclohydrolase 1 Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
Q88JY1 1.28e-35 127 40 3 175 3 folE2 GTP cyclohydrolase 1 2 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
O69531 1.29e-35 127 39 7 208 3 folE GTP cyclohydrolase 1 Mycobacterium leprae (strain TN)
B8ZU42 1.29e-35 127 39 7 208 3 folE GTP cyclohydrolase 1 Mycobacterium leprae (strain Br4923)
Q8PEP3 1.3e-35 127 36 3 183 3 folE GTP cyclohydrolase 1 Xanthomonas axonopodis pv. citri (strain 306)
P59656 1.44e-35 127 37 3 182 3 folE GTP cyclohydrolase 1 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q04MF9 1.44e-35 127 37 3 182 3 folE GTP cyclohydrolase 1 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
B2J1L7 1.63e-35 128 37 5 198 3 folE GTP cyclohydrolase 1 Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
Q3BM80 1.72e-35 127 36 3 183 3 folE GTP cyclohydrolase 1 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
C3PJE8 1.89e-35 127 41 4 178 3 folE GTP cyclohydrolase 1 Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CIP 107346 / CN-1)
Q47KU5 1.99e-35 127 39 3 179 3 folE GTP cyclohydrolase 1 Thermobifida fusca (strain YX)
P51601 2.28e-35 128 40 3 179 1 FOL2 GTP cyclohydrolase 1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
C1CPG4 2.32e-35 126 37 3 182 3 folE GTP cyclohydrolase 1 Streptococcus pneumoniae (strain Taiwan19F-14)
Q4FL89 3.24e-35 126 39 4 188 3 folE GTP cyclohydrolase 1 Pelagibacter ubique (strain HTCC1062)
B4U640 3.34e-35 125 40 2 167 3 folE GTP cyclohydrolase 1 Hydrogenobaculum sp. (strain Y04AAS1)
A7GW42 3.44e-35 126 38 2 178 3 folE GTP cyclohydrolase 1 Campylobacter curvus (strain 525.92)
Q9RYB4 3.65e-35 127 36 3 200 3 folE GTP cyclohydrolase 1 Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
A8FEL2 4.19e-35 125 40 4 185 3 folE GTP cyclohydrolase 1 Bacillus pumilus (strain SAFR-032)
B0U794 4.91e-35 126 36 3 182 3 folE GTP cyclohydrolase 1 Xylella fastidiosa (strain M12)
C1CIH2 5.5e-35 125 37 3 182 3 folE GTP cyclohydrolase 1 Streptococcus pneumoniae (strain P1031)
C1CC81 5.5e-35 125 37 3 182 3 folE GTP cyclohydrolase 1 Streptococcus pneumoniae (strain JJA)
B2ISL9 5.5e-35 125 37 3 182 3 folE GTP cyclohydrolase 1 Streptococcus pneumoniae (strain CGSP14)
B1I918 5.5e-35 125 37 3 182 3 folE GTP cyclohydrolase 1 Streptococcus pneumoniae (strain Hungary19A-6)
Q8A0U0 5.79e-35 125 37 5 196 3 folE GTP cyclohydrolase 1 Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
C5D3E8 6.84e-35 125 39 5 188 3 folE GTP cyclohydrolase 1 Geobacillus sp. (strain WCH70)
Q134L7 7.3e-35 126 36 3 186 3 folE GTP cyclohydrolase 1 Rhodopseudomonas palustris (strain BisB5)
Q9AAY3 7.83e-35 125 41 3 161 3 folE GTP cyclohydrolase 1 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
A0Q2L7 7.89e-35 125 37 3 184 3 folE GTP cyclohydrolase 1 Clostridium novyi (strain NT)
Q89IW2 9.96e-35 126 35 5 216 3 folE GTP cyclohydrolase 1 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A3DHH6 1.02e-34 125 38 4 181 3 folE GTP cyclohydrolase 1 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q3ZYB5 1.05e-34 125 36 3 183 3 folE GTP cyclohydrolase 1 Dehalococcoides mccartyi (strain CBDB1)
A5FQD3 1.05e-34 125 36 3 183 3 folE GTP cyclohydrolase 1 Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1)
Q6FZZ4 1.46e-34 125 38 3 183 3 folE GTP cyclohydrolase 1 Bartonella quintana (strain Toulouse)
Q19980 1.64e-34 125 36 2 201 1 cat-4 GTP cyclohydrolase 1 Caenorhabditis elegans
Q212N0 1.74e-34 125 36 3 186 3 folE GTP cyclohydrolase 1 Rhodopseudomonas palustris (strain BisB18)
A7ZB36 1.99e-34 124 37 2 178 3 folE GTP cyclohydrolase 1 Campylobacter concisus (strain 13826)
A5N6S3 2.47e-34 124 42 3 159 3 folE GTP cyclohydrolase 1 Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9E092 2.47e-34 124 42 3 159 3 folE GTP cyclohydrolase 1 Clostridium kluyveri (strain NBRC 12016)
O66603 2.48e-34 124 40 3 168 3 folE GTP cyclohydrolase 1 Aquifex aeolicus (strain VF5)
Q11JM4 2.89e-34 124 37 2 182 3 folE GTP cyclohydrolase 1 Chelativorans sp. (strain BNC1)
A1USJ5 3.38e-34 124 41 3 166 3 folE GTP cyclohydrolase 1 Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
Q87D63 3.51e-34 124 36 3 182 3 folE GTP cyclohydrolase 1 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I4L2 3.51e-34 124 36 3 182 3 folE GTP cyclohydrolase 1 Xylella fastidiosa (strain M23)
Q6G3J8 3.53e-34 124 37 3 183 3 folE GTP cyclohydrolase 1 Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
O61573 3.62e-34 124 39 2 179 2 gch GTP cyclohydrolase 1 Ostertagia ostertagi
Q8NM84 4.1e-34 123 41 5 178 3 folE GTP cyclohydrolase 1 Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q8XLM2 4.67e-34 123 35 2 180 3 folE GTP cyclohydrolase 1 Clostridium perfringens (strain 13 / Type A)
Q0AM02 5.23e-34 123 36 4 204 3 folE GTP cyclohydrolase 1 Maricaulis maris (strain MCS10)
Q9PC02 7.62e-34 123 35 3 182 3 folE GTP cyclohydrolase 1 Xylella fastidiosa (strain 9a5c)
Q7MWI5 7.94e-34 122 40 3 179 3 folE GTP cyclohydrolase 1 Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
B2RIJ1 7.94e-34 122 40 3 179 3 folE GTP cyclohydrolase 1 Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
Q64P85 8.99e-34 122 39 4 182 3 folE GTP cyclohydrolase 1 Bacteroides fragilis (strain YCH46)
Q5L925 8.99e-34 122 39 4 182 3 folE GTP cyclohydrolase 1 Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q3Z782 9.12e-34 122 38 3 164 3 folE GTP cyclohydrolase 1 Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
B3DR12 1.13e-33 122 41 5 172 3 folE GTP cyclohydrolase 1 Bifidobacterium longum (strain DJO10A)
Q88ST4 1.3e-33 122 36 5 187 3 folE GTP cyclohydrolase 1 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q9KCC7 1.41e-33 122 38 3 178 3 folE GTP cyclohydrolase 1 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q83DE3 1.71e-33 121 39 5 184 3 folE GTP cyclohydrolase 1 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NDB3 1.71e-33 121 39 5 184 3 folE GTP cyclohydrolase 1 Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KFF3 1.71e-33 121 39 5 184 3 folE GTP cyclohydrolase 1 Coxiella burnetii (strain Dugway 5J108-111)
Q88LV4 1.87e-33 121 41 4 186 3 folE1 GTP cyclohydrolase 1 1 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q18BW7 2.03e-33 121 36 2 178 3 folE GTP cyclohydrolase 1 Clostridioides difficile (strain 630)
Q0TRM0 2.25e-33 121 35 2 180 3 folE GTP cyclohydrolase 1 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q38WN0 2.48e-33 121 40 3 180 3 folE GTP cyclohydrolase 1 Latilactobacillus sakei subsp. sakei (strain 23K)
Q8G3S1 3.78e-33 121 40 5 171 3 folE GTP cyclohydrolase 1 Bifidobacterium longum (strain NCC 2705)
A0RBW5 3.9e-33 120 39 5 183 3 folE GTP cyclohydrolase 1 Bacillus thuringiensis (strain Al Hakam)
Q6HL44 4.03e-33 120 39 5 183 3 folE GTP cyclohydrolase 1 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q63DM1 4.03e-33 120 39 5 183 3 folE GTP cyclohydrolase 1 Bacillus cereus (strain ZK / E33L)
Q81FQ8 4.03e-33 120 39 5 183 3 folE GTP cyclohydrolase 1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B9IVN3 4.03e-33 120 39 5 183 3 folE GTP cyclohydrolase 1 Bacillus cereus (strain Q1)
B7HL21 4.03e-33 120 39 5 183 3 folE GTP cyclohydrolase 1 Bacillus cereus (strain AH187)
B7HHR5 4.03e-33 120 39 5 183 3 folE GTP cyclohydrolase 1 Bacillus cereus (strain B4264)
C1EN08 4.03e-33 120 39 5 183 3 folE GTP cyclohydrolase 1 Bacillus cereus (strain 03BB102)
B7IP89 4.03e-33 120 39 5 183 3 folE GTP cyclohydrolase 1 Bacillus cereus (strain G9842)
Q73AY4 4.03e-33 120 39 5 183 3 folE GTP cyclohydrolase 1 Bacillus cereus (strain ATCC 10987 / NRS 248)
B7JGZ6 4.03e-33 120 39 5 183 3 folE GTP cyclohydrolase 1 Bacillus cereus (strain AH820)
Q81SW2 4.03e-33 120 39 5 183 3 folE GTP cyclohydrolase 1 Bacillus anthracis
C3L8S8 4.03e-33 120 39 5 183 3 folE GTP cyclohydrolase 1 Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P598 4.03e-33 120 39 5 183 3 folE GTP cyclohydrolase 1 Bacillus anthracis (strain A0248)
A4QH94 4.1e-33 121 41 5 178 3 folE GTP cyclohydrolase 1 Corynebacterium glutamicum (strain R)
A9VMC0 4.89e-33 120 39 5 183 3 folE GTP cyclohydrolase 1 Bacillus mycoides (strain KBAB4)
B1VSG4 5.27e-33 120 40 4 177 3 folE GTP cyclohydrolase 1 Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
C0ZCC7 5.44e-33 120 37 4 176 3 folE GTP cyclohydrolase 1 Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Q0STY9 6.52e-33 120 35 2 180 3 folE GTP cyclohydrolase 1 Clostridium perfringens (strain SM101 / Type A)
B0S1R1 7.38e-33 120 36 3 182 3 folE GTP cyclohydrolase 1 Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
A7GN48 8.28e-33 120 38 5 183 3 folE GTP cyclohydrolase 1 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q94465 9.16e-33 121 48 0 118 1 gchA GTP cyclohydrolase 1 Dictyostelium discoideum
Q6ACQ1 9.83e-33 120 37 3 180 3 folE GTP cyclohydrolase 1 Leifsonia xyli subsp. xyli (strain CTCB07)
Q1QV64 1.21e-32 119 39 3 171 3 folE GTP cyclohydrolase 1 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q9CGE3 1.25e-32 123 38 3 186 3 folKE Bifunctional protein FolKE Lactococcus lactis subsp. lactis (strain IL1403)
B9JWF1 1.93e-32 119 40 4 192 3 folE GTP cyclohydrolase 1 Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
Q15YG1 2.23e-32 119 36 1 174 3 folE GTP cyclohydrolase 1 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q3IF89 3.19e-32 118 40 3 166 3 folE GTP cyclohydrolase 1 Pseudoalteromonas translucida (strain TAC 125)
Q8GJP4 4.92e-32 122 38 3 183 3 folKE Bifunctional protein FolKE Lactococcus lactis subsp. cremoris (strain MG1363)
A8HUG2 9.05e-32 118 36 3 196 3 folE GTP cyclohydrolase 1 Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
P50141 9.85e-32 118 37 2 183 2 GCH1 GTP cyclohydrolase 1 Gallus gallus
P30793 1.07e-31 119 45 0 119 1 GCH1 GTP cyclohydrolase 1 Homo sapiens
B0U881 1.1e-31 118 36 3 180 3 folE GTP cyclohydrolase 1 Methylobacterium sp. (strain 4-46)
B2IBC4 1.25e-31 117 35 3 191 3 folE GTP cyclohydrolase 1 Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
Q05915 1.5e-31 118 45 0 119 1 Gch1 GTP cyclohydrolase 1 Mus musculus
P22288 1.56e-31 118 45 0 119 1 Gch1 GTP cyclohydrolase 1 Rattus norvegicus
A6X0X0 2.2e-31 117 42 3 169 3 folE GTP cyclohydrolase 1 Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q2SPJ2 3.25e-31 115 35 2 184 3 folE GTP cyclohydrolase 1 Hahella chejuensis (strain KCTC 2396)
Q92I93 3.44e-31 115 38 4 174 3 folE GTP cyclohydrolase 1 Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q1RID0 3.77e-31 115 36 3 171 3 folE GTP cyclohydrolase 1 Rickettsia bellii (strain RML369-C)
A8GUB6 3.77e-31 115 36 3 171 3 folE GTP cyclohydrolase 1 Rickettsia bellii (strain OSU 85-389)
Q8UEK8 7.01e-31 115 42 4 159 3 folE GTP cyclohydrolase 1 Agrobacterium fabrum (strain C58 / ATCC 33970)
C3PNA0 7.14e-31 115 38 5 186 3 folE GTP cyclohydrolase 1 Rickettsia africae (strain ESF-5)
Q0BXB5 7.41e-31 115 35 4 198 3 folE GTP cyclohydrolase 1 Hyphomonas neptunium (strain ATCC 15444)
B1L1S1 7.64e-31 115 38 5 177 3 folE GTP cyclohydrolase 1 Clostridium botulinum (strain Loch Maree / Type A3)
P51599 8.13e-31 118 33 3 210 2 gch-1 GTP cyclohydrolase 1 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
C1FN26 8.41e-31 115 37 3 177 3 folE GTP cyclohydrolase 1 Clostridium botulinum (strain Kyoto / Type A2)
C4K2D8 1.39e-30 114 37 4 174 3 folE GTP cyclohydrolase 1 Rickettsia peacockii (strain Rustic)
A8GRW0 1.53e-30 114 37 4 174 3 folE GTP cyclohydrolase 1 Rickettsia rickettsii (strain Sheila Smith)
B0BXB8 1.53e-30 114 37 4 174 3 folE GTP cyclohydrolase 1 Rickettsia rickettsii (strain Iowa)
Q17WX5 1.73e-30 114 31 3 179 3 folE GTP cyclohydrolase 1 Helicobacter acinonychis (strain Sheeba)
Q9X8I3 1.75e-30 114 38 4 177 3 folE GTP cyclohydrolase 1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
B5Z7T2 2.08e-30 113 31 3 179 3 folE GTP cyclohydrolase 1 Helicobacter pylori (strain G27)
Q97D54 2.32e-30 114 37 5 179 3 folE GTP cyclohydrolase 1 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
C3KVW3 2.51e-30 114 38 4 176 3 folE GTP cyclohydrolase 1 Clostridium botulinum (strain 657 / Type Ba4)
A2BL58 2.7e-30 113 34 4 181 3 folE GTP cyclohydrolase 1 Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5)
B6JME9 2.84e-30 113 31 3 179 3 folE GTP cyclohydrolase 1 Helicobacter pylori (strain P12)
Q9ZKS2 3.92e-30 112 30 3 179 3 folE GTP cyclohydrolase 1 Helicobacter pylori (strain J99 / ATCC 700824)
A6U8C2 4.6e-30 113 40 2 170 3 folE GTP cyclohydrolase 1 Sinorhizobium medicae (strain WSM419)
A8F1F2 7.16e-30 112 37 4 174 3 folE GTP cyclohydrolase 1 Rickettsia massiliae (strain Mtu5)
B2UU76 7.78e-30 112 30 3 179 3 folE GTP cyclohydrolase 1 Helicobacter pylori (strain Shi470)
P56462 9.24e-30 112 30 3 179 3 folE GTP cyclohydrolase 1 Helicobacter pylori (strain ATCC 700392 / 26695)
Q8RH43 1e-29 112 33 3 178 3 folE GTP cyclohydrolase 1 Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
C3MB45 1.02e-29 112 37 4 198 3 folE GTP cyclohydrolase 1 Sinorhizobium fredii (strain NBRC 101917 / NGR234)
A8GN89 1.23e-29 112 36 4 183 3 folE GTP cyclohydrolase 1 Rickettsia akari (strain Hartford)
C5BL73 1.58e-29 111 43 0 119 3 folE GTP cyclohydrolase 1 Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q68WZ4 1.68e-29 111 34 3 171 3 folE GTP cyclohydrolase 1 Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q82EE8 1.74e-29 112 36 4 177 3 folE GTP cyclohydrolase 1 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q4J8S2 2.82e-29 111 33 4 198 3 folE GTP cyclohydrolase 1 Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
Q71Y82 3.01e-29 110 37 5 167 3 folE GTP cyclohydrolase 1 Listeria monocytogenes serotype 4b (strain F2365)
C1KWN3 3.01e-29 110 37 5 167 3 folE GTP cyclohydrolase 1 Listeria monocytogenes serotype 4b (strain CLIP80459)
Q1CSU6 3.07e-29 110 30 3 179 3 folE GTP cyclohydrolase 1 Helicobacter pylori (strain HPAG1)
Q8Y5X1 3.73e-29 110 37 5 167 1 folE GTP cyclohydrolase 1 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q92A75 3.93e-29 110 37 5 167 3 folE GTP cyclohydrolase 1 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
B8DBZ3 4.2e-29 110 37 5 167 3 folE GTP cyclohydrolase 1 Listeria monocytogenes serotype 4a (strain HCC23)
Q9ZDE8 4.21e-29 110 35 3 171 3 folE GTP cyclohydrolase 1 Rickettsia prowazekii (strain Madrid E)
Q4ULX3 5.57e-29 110 35 3 171 3 folE GTP cyclohydrolase 1 Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
A0AK45 5.66e-29 110 38 5 167 3 folE GTP cyclohydrolase 1 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q2Y6B3 7e-29 110 35 2 172 3 folE GTP cyclohydrolase 1 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
A6LWG6 8.8e-29 110 38 5 196 3 folE GTP cyclohydrolase 1 Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
B1IL94 9.45e-29 109 36 3 177 3 folE GTP cyclohydrolase 1 Clostridium botulinum (strain Okra / Type B1)
A5I231 9.45e-29 109 36 3 177 3 folE GTP cyclohydrolase 1 Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FU67 9.45e-29 109 36 3 177 3 folE GTP cyclohydrolase 1 Clostridium botulinum (strain ATCC 19397 / Type A)
A7GDP1 1.18e-28 109 36 3 177 3 folE GTP cyclohydrolase 1 Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
B8I184 2.83e-28 108 35 3 180 3 folE GTP cyclohydrolase 1 Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
A6SZ52 4.21e-28 108 37 2 162 3 folE GTP cyclohydrolase 1 Janthinobacterium sp. (strain Marseille)
Q971G9 7.65e-28 107 36 6 197 3 folE GTP cyclohydrolase 1 Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
P48596 1.85e-27 109 45 0 119 1 Pu GTP cyclohydrolase 1 Drosophila melanogaster
Q92QB4 2.32e-27 106 40 3 150 3 folE GTP cyclohydrolase 1 Rhizobium meliloti (strain 1021)
C3NGB7 7.79e-25 100 32 5 186 3 folE GTP cyclohydrolase 1 Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2)
C3N7B7 1.31e-24 99 33 6 186 3 folE GTP cyclohydrolase 1 Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1)
C3MXF1 1.31e-24 99 33 6 186 3 folE GTP cyclohydrolase 1 Sulfolobus islandicus (strain M.14.25 / Kamchatka #1)
C3MR62 1.31e-24 99 33 6 186 3 folE GTP cyclohydrolase 1 Sulfolobus islandicus (strain L.S.2.15 / Lassen #1)
C4KIH5 1.31e-24 99 33 6 186 3 folE GTP cyclohydrolase 1 Sulfolobus islandicus (strain M.16.4 / Kamchatka #3)
C3MZ97 1.31e-24 99 33 6 186 3 folE GTP cyclohydrolase 1 Sulfolobus islandicus (strain M.16.27)
A8MC60 1.38e-24 99 35 4 183 3 folE GTP cyclohydrolase 1 Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167)
Q980E8 1.64e-24 99 32 5 186 3 folE GTP cyclohydrolase 1 Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
P51596 2.48e-24 99 38 4 167 2 gch1 GTP cyclohydrolase 1 (Fragment) Oncorhynchus mykiss
P51600 7.41e-24 94 48 0 91 2 None GTP cyclohydrolase 1 (Fragment) Phycomyces blakesleeanus
Q7VFG4 8.9e-23 94 35 5 162 3 folE GTP cyclohydrolase 1 Helicobacter hepaticus (strain ATCC 51449 / 3B1)
B1YCT7 2.26e-21 90 32 2 176 3 folE GTP cyclohydrolase 1 Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / NBRC 100436 / V24Sta)
Q8ZWW5 2.59e-21 90 32 3 167 3 folE GTP cyclohydrolase 1 Pyrobaculum aerophilum (strain ATCC 51768 / DSM 7523 / JCM 9630 / CIP 104966 / NBRC 100827 / IM2)
P51598 2.26e-20 84 50 0 79 2 None GTP cyclohydrolase 1 (Fragment) Mucuna pruriens var. utilis
P51597 2.98e-20 84 48 0 79 2 None GTP cyclohydrolase 1 (Fragment) Euglena gracilis
Q8VYU3 6.32e-15 76 26 5 202 1 GCH1 GTP cyclohydrolase 1 Solanum lycopersicum
Q8VYU3 2.12e-11 65 30 7 193 1 GCH1 GTP cyclohydrolase 1 Solanum lycopersicum
Q9SFV7 2.08e-13 71 29 4 190 1 GCH1 GTP cyclohydrolase 1 Arabidopsis thaliana
Q9SFV7 3.13e-08 56 27 4 159 1 GCH1 GTP cyclohydrolase 1 Arabidopsis thaliana
Q8XZK8 2.9e-11 63 26 3 162 3 folE GTP cyclohydrolase 1 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q7NYZ2 3.79e-11 63 27 3 158 3 folE GTP cyclohydrolase 1 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_10010
Feature type CDS
Gene folE
Product GTP cyclohydrolase I FolE
Location 164524 - 165183 (strand: -1)
Length 660 (nucleotides) / 219 (amino acids)
In genomic island -

Contig

Accession ZDB_366
Length 191897 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1237
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01227 GTP cyclohydrolase I

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0302 Coenzyme transport and metabolism (H) H GTP cyclohydrolase I

Kegg Ortholog Annotation(s)

Protein Sequence

MSSLSREAELVHAALIARGLETPLREQTLPPETRKVQIEAHMTEIMKLLNLDLSDDSLADTPKRIAKMYVDEIFSGLDYHNFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDTVIGLSKINRIVQFFAQRPQVQERLTQQILLALQTLLGTTNVAVSIDAVHYCVKARGIRDATSTTTTTSLGGLFKSSQNTRQEFLRAARHI

Flanking regions ( +/- flanking 50bp)

ACGGGTGCAACACAGCACCGGGAGTCACCTGAAAAATAGTCGGAGAAGGTATGTCATCATTAAGCCGGGAAGCAGAACTTGTCCACGCCGCGCTCATCGCACGCGGGCTGGAGACACCATTGCGGGAGCAGACACTGCCGCCGGAAACCCGCAAGGTTCAGATTGAAGCGCATATGACAGAAATTATGAAGCTGCTCAATCTCGACCTGAGCGACGACAGTCTGGCTGATACCCCGAAACGTATCGCGAAGATGTATGTGGATGAAATTTTTTCAGGACTGGATTATCACAATTTCCCGAAAATCACCCTGATTGAAAATAAAATGAAAGTGGATGAGATGGTGACGGTCCGTGATATCACGCTGACCAGCACCTGTGAACACCACTTTGTCACTATCGACGGTAAAGCCACTGTCGCCTATATCCCGAAAGACACCGTTATCGGGCTGTCGAAAATTAACCGCATCGTGCAGTTCTTTGCCCAGCGCCCGCAGGTTCAGGAACGACTGACACAGCAAATTCTGCTGGCACTGCAAACACTGCTCGGCACCACTAATGTGGCGGTATCCATTGACGCGGTGCATTATTGTGTCAAAGCGCGCGGTATCCGTGACGCAACCAGTACTACCACCACCACCTCACTGGGCGGGTTATTTAAATCCAGCCAGAATACCCGCCAGGAATTCCTGCGCGCGGCCCGTCATATTTAACGGATGAATACTTCAGTCACATCTGCCTCTGCCCGTATTGATGTCCTCGA