Homologs in group_1177

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06790 FBDBKF_06790 89.0 Morganella morganii S1 folE GTP cyclohydrolase I FolE
EHELCC_04180 EHELCC_04180 89.0 Morganella morganii S2 folE GTP cyclohydrolase I FolE
NLDBIP_04180 NLDBIP_04180 89.0 Morganella morganii S4 folE GTP cyclohydrolase I FolE
LHKJJB_10010 LHKJJB_10010 89.0 Morganella morganii S3 folE GTP cyclohydrolase I FolE
HKOGLL_08965 HKOGLL_08965 89.0 Morganella morganii S5 folE GTP cyclohydrolase I FolE
F4V73_RS00930 F4V73_RS00930 89.0 Morganella psychrotolerans folE GTP cyclohydrolase I FolE

Distribution of the homologs in the orthogroup group_1177

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1177

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A8GC24 4.88e-134 378 88 0 217 3 folE GTP cyclohydrolase 1 Serratia proteamaculans (strain 568)
A1JU09 1.64e-133 377 87 0 217 3 folE GTP cyclohydrolase 1 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B1JQJ4 2.41e-133 376 87 0 217 3 folE GTP cyclohydrolase 1 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A9R1B1 2.41e-133 376 87 0 217 3 folE GTP cyclohydrolase 1 Yersinia pestis bv. Antiqua (strain Angola)
Q8ZG15 2.41e-133 376 87 0 217 1 folE GTP cyclohydrolase 1 Yersinia pestis
B2JZ02 2.41e-133 376 87 0 217 3 folE GTP cyclohydrolase 1 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FJL1 2.41e-133 376 87 0 217 3 folE GTP cyclohydrolase 1 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
C5BCL9 2.09e-131 371 86 0 217 3 folE GTP cyclohydrolase 1 Edwardsiella ictaluri (strain 93-146)
A8AE79 3.84e-131 371 87 1 219 3 folE GTP cyclohydrolase 1 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A6TBN8 1.27e-130 369 86 1 219 3 folE GTP cyclohydrolase 1 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XP57 1.63e-130 369 86 1 219 3 folE GTP cyclohydrolase 1 Klebsiella pneumoniae (strain 342)
P64209 2.59e-130 369 87 1 218 3 folE GTP cyclohydrolase 1 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P64210 2.59e-130 369 87 1 218 3 folE GTP cyclohydrolase 1 Salmonella typhi
B4TNQ0 2.59e-130 369 87 1 218 3 folE GTP cyclohydrolase 1 Salmonella schwarzengrund (strain CVM19633)
B5BE43 2.59e-130 369 87 1 218 3 folE GTP cyclohydrolase 1 Salmonella paratyphi A (strain AKU_12601)
C0Q0U7 2.59e-130 369 87 1 218 3 folE GTP cyclohydrolase 1 Salmonella paratyphi C (strain RKS4594)
A9N6K0 2.59e-130 369 87 1 218 3 folE GTP cyclohydrolase 1 Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PE52 2.59e-130 369 87 1 218 3 folE GTP cyclohydrolase 1 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SY26 2.59e-130 369 87 1 218 3 folE GTP cyclohydrolase 1 Salmonella newport (strain SL254)
B4TAL5 2.59e-130 369 87 1 218 3 folE GTP cyclohydrolase 1 Salmonella heidelberg (strain SL476)
B5R163 2.59e-130 369 87 1 218 3 folE GTP cyclohydrolase 1 Salmonella enteritidis PT4 (strain P125109)
B5FNJ7 2.59e-130 369 87 1 218 3 folE GTP cyclohydrolase 1 Salmonella dublin (strain CT_02021853)
A9MK63 2.59e-130 369 87 1 218 3 folE GTP cyclohydrolase 1 Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5EYP3 2.59e-130 369 87 1 218 3 folE GTP cyclohydrolase 1 Salmonella agona (strain SL483)
Q3Z053 4.24e-130 368 87 1 218 3 folE GTP cyclohydrolase 1 Shigella sonnei (strain Ss046)
P0A6T8 4.24e-130 368 87 1 218 3 folE GTP cyclohydrolase 1 Shigella flexneri
Q0T2X1 4.24e-130 368 87 1 218 3 folE GTP cyclohydrolase 1 Shigella flexneri serotype 5b (strain 8401)
Q32EN8 4.24e-130 368 87 1 218 3 folE GTP cyclohydrolase 1 Shigella dysenteriae serotype 1 (strain Sd197)
Q31YW1 4.24e-130 368 87 1 218 3 folE GTP cyclohydrolase 1 Shigella boydii serotype 4 (strain Sb227)
B2TVT9 4.24e-130 368 87 1 218 3 folE GTP cyclohydrolase 1 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LVB3 4.24e-130 368 87 1 218 3 folE GTP cyclohydrolase 1 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R9R9 4.24e-130 368 87 1 218 3 folE GTP cyclohydrolase 1 Escherichia coli (strain UTI89 / UPEC)
B1LKQ0 4.24e-130 368 87 1 218 3 folE GTP cyclohydrolase 1 Escherichia coli (strain SMS-3-5 / SECEC)
B6I8K3 4.24e-130 368 87 1 218 3 folE GTP cyclohydrolase 1 Escherichia coli (strain SE11)
B7NCI3 4.24e-130 368 87 1 218 3 folE GTP cyclohydrolase 1 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A6T5 4.24e-130 368 87 1 218 1 folE GTP cyclohydrolase 1 Escherichia coli (strain K12)
B1IYB6 4.24e-130 368 87 1 218 3 folE GTP cyclohydrolase 1 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A6T6 4.24e-130 368 87 1 218 3 folE GTP cyclohydrolase 1 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TFT7 4.24e-130 368 87 1 218 3 folE GTP cyclohydrolase 1 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AD13 4.24e-130 368 87 1 218 3 folE GTP cyclohydrolase 1 Escherichia coli O1:K1 / APEC
A8A214 4.24e-130 368 87 1 218 3 folE GTP cyclohydrolase 1 Escherichia coli O9:H4 (strain HS)
B1X7P1 4.24e-130 368 87 1 218 3 folE GTP cyclohydrolase 1 Escherichia coli (strain K12 / DH10B)
C4ZU03 4.24e-130 368 87 1 218 3 folE GTP cyclohydrolase 1 Escherichia coli (strain K12 / MC4100 / BW2952)
B7M4Z9 4.24e-130 368 87 1 218 3 folE GTP cyclohydrolase 1 Escherichia coli O8 (strain IAI1)
B7MXG6 4.24e-130 368 87 1 218 3 folE GTP cyclohydrolase 1 Escherichia coli O81 (strain ED1a)
B7NMB8 4.24e-130 368 87 1 218 3 folE GTP cyclohydrolase 1 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YWU3 4.24e-130 368 87 1 218 3 folE GTP cyclohydrolase 1 Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A6T7 4.24e-130 368 87 1 218 3 folE GTP cyclohydrolase 1 Escherichia coli O157:H7
B7LAH4 4.24e-130 368 87 1 218 3 folE GTP cyclohydrolase 1 Escherichia coli (strain 55989 / EAEC)
B7MF66 4.24e-130 368 87 1 218 3 folE GTP cyclohydrolase 1 Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UFG9 4.24e-130 368 87 1 218 3 folE GTP cyclohydrolase 1 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZNX6 4.24e-130 368 87 1 218 3 folE GTP cyclohydrolase 1 Escherichia coli O139:H28 (strain E24377A / ETEC)
B5RC32 4.48e-130 368 87 1 218 3 folE GTP cyclohydrolase 1 Salmonella gallinarum (strain 287/91 / NCTC 13346)
Q7N6K7 6.52e-130 367 87 0 218 3 folE GTP cyclohydrolase 1 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q2NUE3 6.7e-130 367 82 0 216 3 folE GTP cyclohydrolase 1 Sodalis glossinidius (strain morsitans)
Q57ME6 1.55e-129 367 87 1 218 3 folE GTP cyclohydrolase 1 Salmonella choleraesuis (strain SC-B67)
A4WCI8 2.95e-129 366 86 1 218 3 folE GTP cyclohydrolase 1 Enterobacter sp. (strain 638)
Q6D3N3 3.04e-129 366 85 0 217 3 folE GTP cyclohydrolase 1 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B2VII2 3.63e-128 363 84 1 219 3 folE GTP cyclohydrolase 1 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
C6DEM6 4.29e-121 345 86 0 217 3 folE GTP cyclohydrolase 1 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
C4LDE6 4.05e-118 337 75 0 210 3 folE GTP cyclohydrolase 1 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
A7N6L2 8.8e-115 329 71 0 216 3 folE GTP cyclohydrolase 1 Vibrio campbellii (strain ATCC BAA-1116)
Q6LQL4 2.16e-113 326 70 0 216 3 folE GTP cyclohydrolase 1 Photobacterium profundum (strain SS9)
Q7MDE5 8.68e-113 324 70 0 216 3 folE GTP cyclohydrolase 1 Vibrio vulnificus (strain YJ016)
Q8D6I7 8.68e-113 324 70 0 216 3 folE GTP cyclohydrolase 1 Vibrio vulnificus (strain CMCP6)
Q9KLX5 2.96e-112 323 70 0 216 3 folE GTP cyclohydrolase 1 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
C4K3L4 2.14e-111 321 71 2 216 3 folE GTP cyclohydrolase 1 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q1LT77 8.1e-109 314 74 1 214 3 folE GTP cyclohydrolase 1 Baumannia cicadellinicola subsp. Homalodisca coagulata
Q8E9L6 5.76e-107 309 71 0 210 3 folE GTP cyclohydrolase 1 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A1REU0 7.55e-107 309 71 0 210 3 folE GTP cyclohydrolase 1 Shewanella sp. (strain W3-18-1)
A4Y2K7 7.55e-107 309 71 0 210 3 folE GTP cyclohydrolase 1 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A9KXZ9 1.17e-106 308 71 0 210 3 folE GTP cyclohydrolase 1 Shewanella baltica (strain OS195)
A6WIA1 1.17e-106 308 71 0 210 3 folE GTP cyclohydrolase 1 Shewanella baltica (strain OS185)
A3CZJ1 1.17e-106 308 71 0 210 3 folE GTP cyclohydrolase 1 Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8E4J0 1.17e-106 308 71 0 210 3 folE GTP cyclohydrolase 1 Shewanella baltica (strain OS223)
A4SPE8 1.39e-106 308 70 0 216 3 folE GTP cyclohydrolase 1 Aeromonas salmonicida (strain A449)
A1S2C7 3.32e-106 307 71 0 214 3 folE GTP cyclohydrolase 1 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A0KIN6 5.17e-106 307 70 0 216 3 folE GTP cyclohydrolase 1 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q0HE51 6.48e-106 306 71 0 210 3 folE GTP cyclohydrolase 1 Shewanella sp. (strain MR-4)
A0L1S4 6.48e-106 306 71 0 210 3 folE GTP cyclohydrolase 1 Shewanella sp. (strain ANA-3)
Q87GZ6 1.13e-105 306 71 0 216 3 folE GTP cyclohydrolase 1 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A3QIQ4 1.21e-105 306 71 0 210 3 folE GTP cyclohydrolase 1 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q0HZU8 1.43e-105 306 71 0 210 3 folE GTP cyclohydrolase 1 Shewanella sp. (strain MR-7)
Q12SG0 1.73e-104 303 71 0 214 3 folE GTP cyclohydrolase 1 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
P43866 5.78e-100 291 63 0 216 3 folE GTP cyclohydrolase 1 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UC59 1.02e-99 291 63 0 216 3 folE GTP cyclohydrolase 1 Haemophilus influenzae (strain PittEE)
Q4QKH4 1.02e-99 291 63 0 216 3 folE GTP cyclohydrolase 1 Haemophilus influenzae (strain 86-028NP)
A5UEW4 1.51e-99 291 63 0 216 3 folE GTP cyclohydrolase 1 Haemophilus influenzae (strain PittGG)
Q492J7 3.29e-98 287 63 0 217 3 folE GTP cyclohydrolase 1 Blochmanniella pennsylvanica (strain BPEN)
B0UUA9 6.12e-98 286 64 0 212 3 folE GTP cyclohydrolase 1 Histophilus somni (strain 2336)
Q0I3F6 6.12e-98 286 64 0 212 3 folE GTP cyclohydrolase 1 Histophilus somni (strain 129Pt)
Q7VRX3 6.78e-98 286 60 0 217 3 folE GTP cyclohydrolase 1 Blochmanniella floridana
Q7VM90 9.08e-98 286 62 0 215 3 folE GTP cyclohydrolase 1 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B5FF36 1.06e-96 283 71 0 216 3 folE GTP cyclohydrolase 1 Aliivibrio fischeri (strain MJ11)
Q5E4E4 1.06e-96 283 71 0 216 3 folE GTP cyclohydrolase 1 Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q65TR0 1.37e-96 283 63 0 212 3 folE GTP cyclohydrolase 1 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
B0BPI8 3.15e-96 282 63 0 212 3 folE GTP cyclohydrolase 1 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GXP9 3.15e-96 282 63 0 212 3 folE GTP cyclohydrolase 1 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N0R3 3.15e-96 282 63 0 212 3 folE GTP cyclohydrolase 1 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B6EGN8 3.39e-96 282 71 0 216 3 folE GTP cyclohydrolase 1 Aliivibrio salmonicida (strain LFI1238)
P57865 4.82e-96 282 63 0 210 3 folE GTP cyclohydrolase 1 Pasteurella multocida (strain Pm70)
Q8KA05 2.09e-84 252 57 1 212 3 folE GTP cyclohydrolase 1 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q8D2N7 3.77e-81 244 57 0 211 3 folE GTP cyclohydrolase 1 Wigglesworthia glossinidia brevipalpis
A5FHM7 5.04e-62 196 48 2 199 3 folE GTP cyclohydrolase 1 Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
B2V9P4 1.03e-42 145 44 2 182 3 folE GTP cyclohydrolase 1 Sulfurihydrogenibium sp. (strain YO3AOP1)
C0QPU5 2.06e-42 144 42 3 182 3 folE GTP cyclohydrolase 1 Persephonella marina (strain DSM 14350 / EX-H1)
A4SF37 5.43e-42 144 41 2 196 3 folE GTP cyclohydrolase 1 Chlorobium phaeovibrioides (strain DSM 265 / 1930)
Q3ATN0 2.71e-41 142 46 3 169 3 folE GTP cyclohydrolase 1 Chlorobium chlorochromatii (strain CaD3)
Q8KEA8 3.87e-40 140 44 2 174 3 folE GTP cyclohydrolase 1 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q7NK98 5.99e-40 139 54 0 124 3 folE GTP cyclohydrolase 1 Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q5M391 6.83e-40 138 39 3 186 3 folE GTP cyclohydrolase 1 Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LYM8 6.83e-40 138 39 3 186 3 folE GTP cyclohydrolase 1 Streptococcus thermophilus (strain CNRZ 1066)
Q8DJB8 9.85e-40 139 52 0 124 3 folE GTP cyclohydrolase 1 Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q2JR69 1.62e-39 138 54 0 124 3 folE GTP cyclohydrolase 1 Synechococcus sp. (strain JA-3-3Ab)
Q7UJJ7 2.54e-39 138 39 2 177 3 folE GTP cyclohydrolase 1 Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q3ADI2 3.99e-39 136 41 4 187 3 folE GTP cyclohydrolase 1 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q8R7N2 5.6e-39 135 41 5 182 3 folE GTP cyclohydrolase 1 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q8YN49 6.23e-39 136 38 3 204 3 folE2 GTP cyclohydrolase 1 2 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
P9WN57 8.6e-39 135 43 5 184 1 folE GTP cyclohydrolase 1 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WN56 8.6e-39 135 43 5 184 3 folE GTP cyclohydrolase 1 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U8T4 8.6e-39 135 43 5 184 3 folE GTP cyclohydrolase 1 Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AI67 8.6e-39 135 43 5 184 3 folE GTP cyclohydrolase 1 Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KPU4 8.6e-39 135 43 5 184 3 folE GTP cyclohydrolase 1 Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P64208 8.6e-39 135 43 5 184 3 folE GTP cyclohydrolase 1 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q2JPT8 8.77e-39 136 53 0 124 3 folE GTP cyclohydrolase 1 Synechococcus sp. (strain JA-2-3B'a(2-13))
A3CKF4 1.04e-38 135 37 3 187 3 folE GTP cyclohydrolase 1 Streptococcus sanguinis (strain SK36)
Q8YLL1 1.06e-38 136 38 6 211 3 folE1 GTP cyclohydrolase 1 1 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q8DZI5 1.25e-38 135 39 4 187 3 folE GTP cyclohydrolase 1 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
A6LFE8 1.69e-38 135 39 3 188 3 folE GTP cyclohydrolase 1 Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
A8FJZ5 1.69e-38 134 42 3 172 3 folE GTP cyclohydrolase 1 Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q3K0Y1 1.69e-38 134 39 4 187 3 folE GTP cyclohydrolase 1 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q5HWX4 1.77e-38 134 43 3 172 3 folE GTP cyclohydrolase 1 Campylobacter jejuni (strain RM1221)
Q607T5 2.83e-38 134 41 2 173 3 folE GTP cyclohydrolase 1 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
P51594 2.84e-38 134 42 3 172 3 folE GTP cyclohydrolase 1 Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A1TG42 3.01e-38 134 44 3 172 3 folE GTP cyclohydrolase 1 Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q5N623 3.58e-38 134 40 3 180 3 folE GTP cyclohydrolase 1 Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q54769 3.58e-38 134 40 3 180 3 folE GTP cyclohydrolase 1 Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
A1VXS2 4.14e-38 133 42 3 172 3 folE GTP cyclohydrolase 1 Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q82Z12 4.3e-38 133 40 4 186 3 folE GTP cyclohydrolase 1 Enterococcus faecalis (strain ATCC 700802 / V583)
B0SRX6 6.42e-38 133 44 3 176 3 folE GTP cyclohydrolase 1 Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0S8X8 6.42e-38 133 44 3 176 3 folE GTP cyclohydrolase 1 Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
Q743Z2 6.48e-38 133 44 5 175 3 folE GTP cyclohydrolase 1 Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
B0K5C1 6.5e-38 133 39 5 183 3 folE GTP cyclohydrolase 1 Thermoanaerobacter sp. (strain X514)
B0KCE5 6.5e-38 133 39 5 183 3 folE GTP cyclohydrolase 1 Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
B9KDZ8 7.11e-38 133 39 2 181 3 folE GTP cyclohydrolase 1 Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
Q056J8 8.41e-38 132 42 4 184 3 folE GTP cyclohydrolase 1 Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04P36 8.41e-38 132 42 4 184 3 folE GTP cyclohydrolase 1 Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
A4T5P2 9.85e-38 133 40 3 186 3 folE GTP cyclohydrolase 1 Mycolicibacterium gilvum (strain PYR-GCK)
Q8E549 1.03e-37 132 39 4 187 3 folE GTP cyclohydrolase 1 Streptococcus agalactiae serotype III (strain NEM316)
Q8FMG3 1.15e-37 132 46 5 167 3 folE GTP cyclohydrolase 1 Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
A0QA85 1.21e-37 133 46 5 162 3 folE GTP cyclohydrolase 1 Mycobacterium avium (strain 104)
O66603 1.45e-37 132 40 3 184 3 folE GTP cyclohydrolase 1 Aquifex aeolicus (strain VF5)
A0Q2L7 1.54e-37 132 38 3 185 3 folE GTP cyclohydrolase 1 Clostridium novyi (strain NT)
Q55759 1.56e-37 133 50 0 124 3 folE GTP cyclohydrolase 1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
O13774 1.82e-37 133 39 3 186 1 SPAC17A5.13 GTP cyclohydrolase 1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q8G0L4 1.99e-37 132 43 3 169 3 folE GTP cyclohydrolase 1 Brucella suis biovar 1 (strain 1330)
A9M586 1.99e-37 132 43 3 169 3 folE GTP cyclohydrolase 1 Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q8YH94 2.46e-37 132 43 3 169 3 folE GTP cyclohydrolase 1 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RJ47 2.46e-37 132 43 3 169 3 folE GTP cyclohydrolase 1 Brucella melitensis biotype 2 (strain ATCC 23457)
Q57D61 2.46e-37 132 43 3 169 3 folE GTP cyclohydrolase 1 Brucella abortus biovar 1 (strain 9-941)
Q2YQ03 2.46e-37 132 43 3 169 3 folE GTP cyclohydrolase 1 Brucella abortus (strain 2308)
B2S5T0 2.46e-37 132 43 3 169 3 folE GTP cyclohydrolase 1 Brucella abortus (strain S19)
B0CGM4 2.49e-37 132 43 3 169 3 folE GTP cyclohydrolase 1 Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VQL0 2.57e-37 132 43 3 169 3 folE GTP cyclohydrolase 1 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8DUG2 2.6e-37 131 40 3 185 3 folE GTP cyclohydrolase 1 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
A4J5D0 3.12e-37 131 40 4 180 3 folE GTP cyclohydrolase 1 Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
A4VVH1 3.41e-37 131 40 3 183 3 folE GTP cyclohydrolase 1 Streptococcus suis (strain 05ZYH33)
A4W1S9 3.41e-37 131 40 3 183 3 folE GTP cyclohydrolase 1 Streptococcus suis (strain 98HAH33)
B5YJV0 3.62e-37 131 36 2 183 3 folE GTP cyclohydrolase 1 Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
B8ZL26 4.14e-37 130 38 3 183 3 folE GTP cyclohydrolase 1 Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
P51595 4.92e-37 130 38 3 183 3 folE GTP cyclohydrolase 1 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
C1CB65 4.92e-37 130 38 3 183 3 folE GTP cyclohydrolase 1 Streptococcus pneumoniae (strain 70585)
B5E6W5 4.92e-37 130 38 3 183 3 folE GTP cyclohydrolase 1 Streptococcus pneumoniae serotype 19F (strain G54)
B2J1L7 5.26e-37 132 49 0 124 3 folE GTP cyclohydrolase 1 Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
A7H1R1 6.78e-37 130 41 3 172 3 folE GTP cyclohydrolase 1 Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
P59656 6.95e-37 130 38 3 183 3 folE GTP cyclohydrolase 1 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q04MF9 6.95e-37 130 38 3 183 3 folE GTP cyclohydrolase 1 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q8XLM2 7.08e-37 130 35 2 182 3 folE GTP cyclohydrolase 1 Clostridium perfringens (strain 13 / Type A)
Q3ZYB5 7.19e-37 130 36 3 186 3 folE GTP cyclohydrolase 1 Dehalococcoides mccartyi (strain CBDB1)
A5FQD3 7.19e-37 130 36 3 186 3 folE GTP cyclohydrolase 1 Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1)
Q8EYG1 9.86e-37 130 43 3 177 3 folE GTP cyclohydrolase 1 Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72LY8 9.86e-37 130 43 3 177 3 folE GTP cyclohydrolase 1 Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
A5D2D8 1.02e-36 130 43 3 168 3 folE GTP cyclohydrolase 1 Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
B4U640 1.05e-36 129 38 2 184 3 folE GTP cyclohydrolase 1 Hydrogenobaculum sp. (strain Y04AAS1)
C1CPG4 1.22e-36 129 37 3 183 3 folE GTP cyclohydrolase 1 Streptococcus pneumoniae (strain Taiwan19F-14)
P19465 1.23e-36 130 39 4 187 1 folE GTP cyclohydrolase 1 Bacillus subtilis (strain 168)
A5N6S3 1.29e-36 129 39 3 187 3 folE GTP cyclohydrolase 1 Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9E092 1.29e-36 129 39 3 187 3 folE GTP cyclohydrolase 1 Clostridium kluyveri (strain NBRC 12016)
Q47KU5 1.36e-36 130 38 4 188 3 folE GTP cyclohydrolase 1 Thermobifida fusca (strain YX)
A0PV57 1.51e-36 130 43 5 175 3 folE GTP cyclohydrolase 1 Mycobacterium ulcerans (strain Agy99)
B2HJ53 1.52e-36 130 43 5 175 3 folE GTP cyclohydrolase 1 Mycobacterium marinum (strain ATCC BAA-535 / M)
Q9RYB4 1.74e-36 130 38 2 176 3 folE GTP cyclohydrolase 1 Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
P0A3E9 1.86e-36 129 39 3 181 3 folE GTP cyclohydrolase 1 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XCA9 1.86e-36 129 39 3 181 3 folE GTP cyclohydrolase 1 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0C0C2 1.86e-36 129 39 3 181 3 folE GTP cyclohydrolase 1 Streptococcus pyogenes serotype M1
Q0A939 2.34e-36 129 38 3 192 3 folE GTP cyclohydrolase 1 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
C1CIH2 2.48e-36 129 37 3 183 3 folE GTP cyclohydrolase 1 Streptococcus pneumoniae (strain P1031)
C1CC81 2.48e-36 129 37 3 183 3 folE GTP cyclohydrolase 1 Streptococcus pneumoniae (strain JJA)
B2ISL9 2.48e-36 129 37 3 183 3 folE GTP cyclohydrolase 1 Streptococcus pneumoniae (strain CGSP14)
B1I918 2.48e-36 129 37 3 183 3 folE GTP cyclohydrolase 1 Streptococcus pneumoniae (strain Hungary19A-6)
A3DHH6 4.95e-36 128 39 4 181 3 folE GTP cyclohydrolase 1 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q134L7 5.15e-36 129 36 4 195 3 folE GTP cyclohydrolase 1 Rhodopseudomonas palustris (strain BisB5)
Q9HYG8 5.9e-36 128 40 3 189 3 folE1 GTP cyclohydrolase 1 1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A8AZD8 5.94e-36 128 38 3 184 3 folE GTP cyclohydrolase 1 Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
Q884Q3 6.36e-36 127 37 2 190 3 folE2 GTP cyclohydrolase 1 2 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
A7Z630 6.67e-36 128 37 4 187 3 folE GTP cyclohydrolase 1 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
B1MGU9 7.42e-36 128 43 3 172 3 folE GTP cyclohydrolase 1 Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
Q212N0 7.83e-36 129 35 4 195 3 folE GTP cyclohydrolase 1 Rhodopseudomonas palustris (strain BisB18)
A7GW42 8.74e-36 127 37 2 181 3 folE GTP cyclohydrolase 1 Campylobacter curvus (strain 525.92)
Q8A0U0 8.78e-36 127 38 5 196 3 folE GTP cyclohydrolase 1 Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q0TRM0 9.32e-36 127 34 2 182 3 folE GTP cyclohydrolase 1 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q8NM84 1.16e-35 127 42 5 178 3 folE GTP cyclohydrolase 1 Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
P0DB31 1.22e-35 127 39 3 181 3 folE GTP cyclohydrolase 1 Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DB30 1.22e-35 127 39 3 181 3 folE GTP cyclohydrolase 1 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q64P85 1.22e-35 127 38 5 195 3 folE GTP cyclohydrolase 1 Bacteroides fragilis (strain YCH46)
Q5L925 1.22e-35 127 38 5 195 3 folE GTP cyclohydrolase 1 Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q98LQ6 1.37e-35 127 37 4 199 3 folE GTP cyclohydrolase 1 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
A2REL9 1.49e-35 127 39 3 181 3 folE GTP cyclohydrolase 1 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q18BW7 1.5e-35 127 36 2 180 3 folE GTP cyclohydrolase 1 Clostridioides difficile (strain 630)
Q2IY20 1.69e-35 128 35 4 196 3 folE GTP cyclohydrolase 1 Rhodopseudomonas palustris (strain HaA2)
A7ZB36 2.16e-35 126 37 2 181 3 folE GTP cyclohydrolase 1 Campylobacter concisus (strain 13826)
Q4FL89 2.27e-35 127 37 4 204 3 folE GTP cyclohydrolase 1 Pelagibacter ubique (strain HTCC1062)
B5XLE8 2.31e-35 126 39 3 181 3 folE GTP cyclohydrolase 1 Streptococcus pyogenes serotype M49 (strain NZ131)
Q0STY9 2.38e-35 126 34 2 182 3 folE GTP cyclohydrolase 1 Clostridium perfringens (strain SM101 / Type A)
Q11JM4 2.39e-35 127 37 2 185 3 folE GTP cyclohydrolase 1 Chelativorans sp. (strain BNC1)
A8FEL2 2.47e-35 126 37 4 188 3 folE GTP cyclohydrolase 1 Bacillus pumilus (strain SAFR-032)
Q3Z782 2.9e-35 126 37 3 181 3 folE GTP cyclohydrolase 1 Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
B1HTA3 3.2e-35 126 37 4 180 3 folE GTP cyclohydrolase 1 Lysinibacillus sphaericus (strain C3-41)
O69531 3.48e-35 126 38 7 205 3 folE GTP cyclohydrolase 1 Mycobacterium leprae (strain TN)
B8ZU42 3.48e-35 126 38 7 205 3 folE GTP cyclohydrolase 1 Mycobacterium leprae (strain Br4923)
C3PJE8 4.01e-35 126 41 4 177 3 folE GTP cyclohydrolase 1 Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CIP 107346 / CN-1)
Q8P3B0 5.54e-35 125 35 3 188 3 folE GTP cyclohydrolase 1 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
A1USJ5 5.55e-35 126 42 3 164 3 folE GTP cyclohydrolase 1 Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
P51601 6.49e-35 127 40 3 180 1 FOL2 GTP cyclohydrolase 1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q5KXT7 9.33e-35 125 37 4 191 3 folE GTP cyclohydrolase 1 Geobacillus kaustophilus (strain HTA426)
A4QH94 1.14e-34 125 42 5 178 3 folE GTP cyclohydrolase 1 Corynebacterium glutamicum (strain R)
Q7M933 1.14e-34 124 36 3 176 3 folE GTP cyclohydrolase 1 Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q9I351 1.26e-34 124 36 3 190 3 folE2 GTP cyclohydrolase 1 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B0S1R1 1.33e-34 124 36 3 182 3 folE GTP cyclohydrolase 1 Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
Q7MWI5 1.33e-34 124 38 3 191 3 folE GTP cyclohydrolase 1 Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
B2RIJ1 1.33e-34 124 38 3 191 3 folE GTP cyclohydrolase 1 Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
B3DR12 1.6e-34 124 42 5 171 3 folE GTP cyclohydrolase 1 Bifidobacterium longum (strain DJO10A)
Q88JY1 1.76e-34 124 38 4 181 3 folE2 GTP cyclohydrolase 1 2 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B3QE25 2.04e-34 125 35 3 190 3 folE GTP cyclohydrolase 1 Rhodopseudomonas palustris (strain TIE-1)
Q6N4E7 2.04e-34 125 35 3 190 3 folE GTP cyclohydrolase 1 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
P0C0C1 2.24e-34 124 38 3 181 3 folE GTP cyclohydrolase 1 Streptococcus pyogenes
C5D3E8 2.54e-34 124 36 5 192 3 folE GTP cyclohydrolase 1 Geobacillus sp. (strain WCH70)
Q887V1 2.75e-34 124 38 3 189 3 folE1 GTP cyclohydrolase 1 1 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
C1DHG2 3.36e-34 123 36 3 190 3 folE GTP cyclohydrolase 1 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q88ST4 3.38e-34 123 36 5 188 3 folE GTP cyclohydrolase 1 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
B0U794 3.74e-34 124 34 3 189 3 folE GTP cyclohydrolase 1 Xylella fastidiosa (strain M12)
Q38WN0 3.77e-34 123 38 3 187 3 folE GTP cyclohydrolase 1 Latilactobacillus sakei subsp. sakei (strain 23K)
Q9KCC7 4.08e-34 123 37 3 183 3 folE GTP cyclohydrolase 1 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
O61573 4.11e-34 124 40 2 167 2 gch GTP cyclohydrolase 1 Ostertagia ostertagi
Q19980 5.17e-34 124 40 2 172 1 cat-4 GTP cyclohydrolase 1 Caenorhabditis elegans
Q8G3S1 5.33e-34 123 41 5 170 3 folE GTP cyclohydrolase 1 Bifidobacterium longum (strain NCC 2705)
Q94465 6.43e-34 124 36 3 203 1 gchA GTP cyclohydrolase 1 Dictyostelium discoideum
Q9AAY3 6.92e-34 123 40 3 165 3 folE GTP cyclohydrolase 1 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q6G3J8 7.16e-34 123 40 3 164 3 folE GTP cyclohydrolase 1 Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
A8HUG2 7.59e-34 123 36 3 202 3 folE GTP cyclohydrolase 1 Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q8PEP3 7.73e-34 123 34 3 186 3 folE GTP cyclohydrolase 1 Xanthomonas axonopodis pv. citri (strain 306)
Q83DE3 8.2e-34 122 39 5 184 3 folE GTP cyclohydrolase 1 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NDB3 8.2e-34 122 39 5 184 3 folE GTP cyclohydrolase 1 Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KFF3 8.2e-34 122 39 5 184 3 folE GTP cyclohydrolase 1 Coxiella burnetii (strain Dugway 5J108-111)
Q3BM80 8.7e-34 122 35 3 188 3 folE GTP cyclohydrolase 1 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q87D63 1.39e-33 122 34 3 189 3 folE GTP cyclohydrolase 1 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I4L2 1.39e-33 122 34 3 189 3 folE GTP cyclohydrolase 1 Xylella fastidiosa (strain M23)
Q9CGE3 2.05e-33 125 38 3 184 3 folKE Bifunctional protein FolKE Lactococcus lactis subsp. lactis (strain IL1403)
Q89IW2 2.2e-33 122 34 3 190 3 folE GTP cyclohydrolase 1 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q8GJP4 2.47e-33 125 37 5 209 3 folKE Bifunctional protein FolKE Lactococcus lactis subsp. cremoris (strain MG1363)
Q9PC02 4.06e-33 121 33 3 189 3 folE GTP cyclohydrolase 1 Xylella fastidiosa (strain 9a5c)
A7GN48 5.04e-33 120 36 5 188 3 folE GTP cyclohydrolase 1 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
B1VSG4 5.2e-33 120 40 4 172 3 folE GTP cyclohydrolase 1 Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
B0U881 7.56e-33 121 35 3 196 3 folE GTP cyclohydrolase 1 Methylobacterium sp. (strain 4-46)
A0RBW5 9.7e-33 120 36 5 188 3 folE GTP cyclohydrolase 1 Bacillus thuringiensis (strain Al Hakam)
Q6HL44 1.06e-32 119 36 5 188 3 folE GTP cyclohydrolase 1 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q63DM1 1.06e-32 119 36 5 188 3 folE GTP cyclohydrolase 1 Bacillus cereus (strain ZK / E33L)
Q81FQ8 1.06e-32 119 36 5 188 3 folE GTP cyclohydrolase 1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B9IVN3 1.06e-32 119 36 5 188 3 folE GTP cyclohydrolase 1 Bacillus cereus (strain Q1)
B7HL21 1.06e-32 119 36 5 188 3 folE GTP cyclohydrolase 1 Bacillus cereus (strain AH187)
B7HHR5 1.06e-32 119 36 5 188 3 folE GTP cyclohydrolase 1 Bacillus cereus (strain B4264)
C1EN08 1.06e-32 119 36 5 188 3 folE GTP cyclohydrolase 1 Bacillus cereus (strain 03BB102)
B7IP89 1.06e-32 119 36 5 188 3 folE GTP cyclohydrolase 1 Bacillus cereus (strain G9842)
Q73AY4 1.06e-32 119 36 5 188 3 folE GTP cyclohydrolase 1 Bacillus cereus (strain ATCC 10987 / NRS 248)
B7JGZ6 1.06e-32 119 36 5 188 3 folE GTP cyclohydrolase 1 Bacillus cereus (strain AH820)
Q81SW2 1.06e-32 119 36 5 188 3 folE GTP cyclohydrolase 1 Bacillus anthracis
C3L8S8 1.06e-32 119 36 5 188 3 folE GTP cyclohydrolase 1 Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P598 1.06e-32 119 36 5 188 3 folE GTP cyclohydrolase 1 Bacillus anthracis (strain A0248)
A9VMC0 1.07e-32 119 36 5 188 3 folE GTP cyclohydrolase 1 Bacillus mycoides (strain KBAB4)
B9JWF1 1.3e-32 120 37 4 196 3 folE GTP cyclohydrolase 1 Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
P50141 1.45e-32 120 37 2 182 2 GCH1 GTP cyclohydrolase 1 Gallus gallus
P30793 1.48e-32 121 44 0 123 1 GCH1 GTP cyclohydrolase 1 Homo sapiens
Q6FZZ4 1.49e-32 120 41 3 164 3 folE GTP cyclohydrolase 1 Bartonella quintana (strain Toulouse)
Q05915 1.66e-32 120 44 0 123 1 Gch1 GTP cyclohydrolase 1 Mus musculus
P22288 2.1e-32 120 44 0 123 1 Gch1 GTP cyclohydrolase 1 Rattus norvegicus
Q1QV64 2.54e-32 118 38 3 170 3 folE GTP cyclohydrolase 1 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
A6X0X0 3.88e-32 119 42 3 169 3 folE GTP cyclohydrolase 1 Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q9X8I3 5.4e-32 118 38 4 181 3 folE GTP cyclohydrolase 1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
C0ZCC7 7.47e-32 117 34 4 184 3 folE GTP cyclohydrolase 1 Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Q0AM02 7.93e-32 118 34 2 182 3 folE GTP cyclohydrolase 1 Maricaulis maris (strain MCS10)
P51599 1.86e-31 119 34 3 209 2 gch-1 GTP cyclohydrolase 1 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Q15YG1 2.53e-31 116 34 1 179 3 folE GTP cyclohydrolase 1 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
B5Z7T2 2.61e-31 115 33 3 168 3 folE GTP cyclohydrolase 1 Helicobacter pylori (strain G27)
Q3IF89 2.67e-31 116 35 3 184 3 folE GTP cyclohydrolase 1 Pseudoalteromonas translucida (strain TAC 125)
B6JME9 2.75e-31 115 33 3 168 3 folE GTP cyclohydrolase 1 Helicobacter pylori (strain P12)
Q4J8S2 3.28e-31 116 35 4 188 3 folE GTP cyclohydrolase 1 Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
Q1RID0 4.27e-31 115 35 3 182 3 folE GTP cyclohydrolase 1 Rickettsia bellii (strain RML369-C)
A8GUB6 4.27e-31 115 35 3 182 3 folE GTP cyclohydrolase 1 Rickettsia bellii (strain OSU 85-389)
Q82EE8 4.51e-31 115 36 4 181 3 folE GTP cyclohydrolase 1 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q9ZKS2 6.64e-31 115 33 3 168 3 folE GTP cyclohydrolase 1 Helicobacter pylori (strain J99 / ATCC 700824)
B2UU76 7.48e-31 114 33 3 168 3 folE GTP cyclohydrolase 1 Helicobacter pylori (strain Shi470)
P56462 1.05e-30 114 30 3 182 3 folE GTP cyclohydrolase 1 Helicobacter pylori (strain ATCC 700392 / 26695)
Q6ACQ1 1.07e-30 114 35 3 180 3 folE GTP cyclohydrolase 1 Leifsonia xyli subsp. xyli (strain CTCB07)
Q97D54 1.1e-30 114 37 5 181 3 folE GTP cyclohydrolase 1 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q92I93 1.26e-30 114 36 4 185 3 folE GTP cyclohydrolase 1 Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q17WX5 1.29e-30 114 33 3 168 3 folE GTP cyclohydrolase 1 Helicobacter acinonychis (strain Sheeba)
A2BL58 1.54e-30 114 34 4 183 3 folE GTP cyclohydrolase 1 Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5)
Q88LV4 2.26e-30 114 37 4 193 3 folE1 GTP cyclohydrolase 1 1 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q8Y5X1 2.44e-30 113 34 5 189 1 folE GTP cyclohydrolase 1 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q92A75 2.5e-30 113 34 5 189 3 folE GTP cyclohydrolase 1 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q71Y82 2.52e-30 113 35 5 188 3 folE GTP cyclohydrolase 1 Listeria monocytogenes serotype 4b (strain F2365)
C1KWN3 2.52e-30 113 35 5 188 3 folE GTP cyclohydrolase 1 Listeria monocytogenes serotype 4b (strain CLIP80459)
Q1CSU6 2.86e-30 113 32 3 168 3 folE GTP cyclohydrolase 1 Helicobacter pylori (strain HPAG1)
C5BL73 3.12e-30 113 44 0 119 3 folE GTP cyclohydrolase 1 Teredinibacter turnerae (strain ATCC 39867 / T7901)
B8DBZ3 3.2e-30 113 34 5 189 3 folE GTP cyclohydrolase 1 Listeria monocytogenes serotype 4a (strain HCC23)
C1FN26 3.38e-30 113 36 3 179 3 folE GTP cyclohydrolase 1 Clostridium botulinum (strain Kyoto / Type A2)
A0AK45 4.91e-30 112 35 5 188 3 folE GTP cyclohydrolase 1 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
B2IBC4 6.18e-30 113 35 4 194 3 folE GTP cyclohydrolase 1 Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
C4K2D8 6.42e-30 112 35 4 185 3 folE GTP cyclohydrolase 1 Rickettsia peacockii (strain Rustic)
A8GRW0 6.55e-30 112 35 4 185 3 folE GTP cyclohydrolase 1 Rickettsia rickettsii (strain Sheila Smith)
B0BXB8 6.55e-30 112 35 4 185 3 folE GTP cyclohydrolase 1 Rickettsia rickettsii (strain Iowa)
A6U8C2 7.04e-30 113 39 2 174 3 folE GTP cyclohydrolase 1 Sinorhizobium medicae (strain WSM419)
Q2SPJ2 8.08e-30 112 34 2 184 3 folE GTP cyclohydrolase 1 Hahella chejuensis (strain KCTC 2396)
B8I184 1.01e-29 112 35 3 185 3 folE GTP cyclohydrolase 1 Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
Q2Y6B3 1.09e-29 112 36 2 172 3 folE GTP cyclohydrolase 1 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
B1L1S1 1.13e-29 112 36 5 180 3 folE GTP cyclohydrolase 1 Clostridium botulinum (strain Loch Maree / Type A3)
Q8UEK8 1.31e-29 112 37 4 202 3 folE GTP cyclohydrolase 1 Agrobacterium fabrum (strain C58 / ATCC 33970)
A8F1F2 1.43e-29 111 35 4 182 3 folE GTP cyclohydrolase 1 Rickettsia massiliae (strain Mtu5)
Q68WZ4 1.78e-29 111 32 3 185 3 folE GTP cyclohydrolase 1 Rickettsia typhi (strain ATCC VR-144 / Wilmington)
C3PNA0 1.85e-29 111 38 3 171 3 folE GTP cyclohydrolase 1 Rickettsia africae (strain ESF-5)
Q8RH43 2.27e-29 111 32 3 183 3 folE GTP cyclohydrolase 1 Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
C3MB45 3.05e-29 111 38 2 174 3 folE GTP cyclohydrolase 1 Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q9ZDE8 3.28e-29 110 33 3 185 3 folE GTP cyclohydrolase 1 Rickettsia prowazekii (strain Madrid E)
C3KVW3 3.37e-29 110 36 4 179 3 folE GTP cyclohydrolase 1 Clostridium botulinum (strain 657 / Type Ba4)
Q4ULX3 3.77e-29 110 33 3 182 3 folE GTP cyclohydrolase 1 Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
A6SZ52 4.84e-29 110 38 2 162 3 folE GTP cyclohydrolase 1 Janthinobacterium sp. (strain Marseille)
Q971G9 7.61e-29 110 36 6 197 3 folE GTP cyclohydrolase 1 Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
P48596 9.64e-29 112 45 0 122 1 Pu GTP cyclohydrolase 1 Drosophila melanogaster
A8GN89 1.48e-28 109 35 3 171 3 folE GTP cyclohydrolase 1 Rickettsia akari (strain Hartford)
Q0BXB5 1.55e-28 109 35 3 183 3 folE GTP cyclohydrolase 1 Hyphomonas neptunium (strain ATCC 15444)
B1IL94 3.9e-28 108 35 3 179 3 folE GTP cyclohydrolase 1 Clostridium botulinum (strain Okra / Type B1)
A5I231 3.9e-28 108 35 3 179 3 folE GTP cyclohydrolase 1 Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FU67 3.9e-28 108 35 3 179 3 folE GTP cyclohydrolase 1 Clostridium botulinum (strain ATCC 19397 / Type A)
A7GDP1 5.09e-28 107 35 3 179 3 folE GTP cyclohydrolase 1 Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
Q92QB4 3.18e-27 106 37 3 180 3 folE GTP cyclohydrolase 1 Rhizobium meliloti (strain 1021)
A8MC60 7.12e-27 104 36 5 184 3 folE GTP cyclohydrolase 1 Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167)
C3NGB7 8.58e-27 105 33 5 187 3 folE GTP cyclohydrolase 1 Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2)
A6LWG6 9.72e-27 104 37 5 189 3 folE GTP cyclohydrolase 1 Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
C3N7B7 1.52e-26 104 34 6 187 3 folE GTP cyclohydrolase 1 Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1)
C3MXF1 1.52e-26 104 34 6 187 3 folE GTP cyclohydrolase 1 Sulfolobus islandicus (strain M.14.25 / Kamchatka #1)
C3MR62 1.52e-26 104 34 6 187 3 folE GTP cyclohydrolase 1 Sulfolobus islandicus (strain L.S.2.15 / Lassen #1)
C4KIH5 1.52e-26 104 34 6 187 3 folE GTP cyclohydrolase 1 Sulfolobus islandicus (strain M.16.4 / Kamchatka #3)
C3MZ97 1.52e-26 104 34 6 187 3 folE GTP cyclohydrolase 1 Sulfolobus islandicus (strain M.16.27)
Q980E8 2.07e-26 103 33 5 187 3 folE GTP cyclohydrolase 1 Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
P51600 1.13e-24 96 48 0 91 2 None GTP cyclohydrolase 1 (Fragment) Phycomyces blakesleeanus
P51596 1.23e-24 100 39 3 150 2 gch1 GTP cyclohydrolase 1 (Fragment) Oncorhynchus mykiss
Q7VFG4 9.71e-24 97 35 5 165 3 folE GTP cyclohydrolase 1 Helicobacter hepaticus (strain ATCC 51449 / 3B1)
P51598 8.65e-21 85 51 0 79 2 None GTP cyclohydrolase 1 (Fragment) Mucuna pruriens var. utilis
P51597 1.43e-20 85 49 0 79 2 None GTP cyclohydrolase 1 (Fragment) Euglena gracilis
Q8ZWW5 2.36e-20 87 33 3 157 3 folE GTP cyclohydrolase 1 Pyrobaculum aerophilum (strain ATCC 51768 / DSM 7523 / JCM 9630 / CIP 104966 / NBRC 100827 / IM2)
B1YCT7 6.69e-20 86 32 3 171 3 folE GTP cyclohydrolase 1 Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / NBRC 100436 / V24Sta)
Q8VYU3 2.79e-16 80 26 4 194 1 GCH1 GTP cyclohydrolase 1 Solanum lycopersicum
Q8VYU3 1.61e-11 66 29 6 182 1 GCH1 GTP cyclohydrolase 1 Solanum lycopersicum
Q9SFV7 6.04e-13 70 28 4 194 1 GCH1 GTP cyclohydrolase 1 Arabidopsis thaliana
Q9SFV7 5.68e-08 55 28 3 145 1 GCH1 GTP cyclohydrolase 1 Arabidopsis thaliana
Q8XZK8 2.39e-12 66 29 0 122 3 folE GTP cyclohydrolase 1 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q7NYZ2 5.67e-12 65 25 2 159 3 folE GTP cyclohydrolase 1 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS03150
Feature type CDS
Gene folE
Product GTP cyclohydrolase I FolE
Location 695247 - 695909 (strand: 1)
Length 663 (nucleotides) / 220 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1177
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01227 GTP cyclohydrolase I

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0302 Coenzyme transport and metabolism (H) H GTP cyclohydrolase I

Kegg Ortholog Annotation(s)

Protein Sequence

MSSTLSKEAQWVHAALVERGLETPLREPKLSPSESKQQIKHHMTEVMKLLNLDLSDDSLAETPHRIAKMYVDEIFSGLDYHNFPKITLIENKMQVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDKVIGLSKINRIVQFFAQRPQVQERLTQQILIALQTLLGTKNVAVSIDAVHYCVKARGIRDATSATTTTSLGGLFKSSQNTRQEFLRAVRHL

Flanking regions ( +/- flanking 50bp)

CGTTGAATTAGGTAACAGAGACTTAATTAATGTGTTTATCGGAGAGTCCAATGTCATCAACATTAAGTAAAGAGGCGCAATGGGTACATGCCGCGTTAGTGGAGCGTGGTTTGGAAACGCCTCTTCGTGAGCCAAAACTTTCACCCAGTGAGAGTAAACAACAAATTAAACATCACATGACGGAAGTGATGAAATTGTTAAACCTAGATTTGAGTGATGACAGTTTAGCGGAAACGCCACATCGCATTGCGAAAATGTATGTTGATGAAATTTTTTCAGGCTTGGATTATCACAACTTTCCTAAAATCACCCTGATTGAAAATAAAATGCAGGTTGATGAAATGGTCACTGTTCGTGACATCACATTAACCAGTACTTGTGAGCACCATTTTGTCACTATTGATGGTAAAGCAACGGTTGCTTATATTCCTAAAGATAAAGTGATTGGTTTATCAAAAATTAACCGTATTGTGCAGTTCTTCGCACAACGCCCTCAAGTGCAAGAGCGTTTAACGCAACAAATATTGATTGCCTTACAAACGCTATTGGGGACGAAAAACGTTGCTGTCTCTATTGATGCCGTTCACTATTGTGTAAAAGCAAGAGGCATTCGTGATGCAACCAGTGCAACCACCACAACTTCATTAGGTGGACTATTTAAATCTAGCCAAAATACTCGCCAAGAGTTTTTGCGTGCTGTACGCCATCTTTGAGATGAATAAATGGAACAAAGTTCACGTCAACGCATCGACGCTTTAGATGC