Homologs in group_21

Help

18 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08075 FBDBKF_08075 100.0 Morganella morganii S1 dmsB DMSO/selenate family reductase complex B subunit
FBDBKF_10455 FBDBKF_10455 48.5 Morganella morganii S1 dmsB DMSO/selenate family reductase complex B subunit
EHELCC_13905 EHELCC_13905 100.0 Morganella morganii S2 dmsB DMSO/selenate family reductase complex B subunit
EHELCC_14790 EHELCC_14790 48.5 Morganella morganii S2 dmsB DMSO/selenate family reductase complex B subunit
NLDBIP_14350 NLDBIP_14350 100.0 Morganella morganii S4 dmsB DMSO/selenate family reductase complex B subunit
NLDBIP_14620 NLDBIP_14620 48.5 Morganella morganii S4 dmsB DMSO/selenate family reductase complex B subunit
LHKJJB_14725 LHKJJB_14725 48.5 Morganella morganii S3 dmsB DMSO/selenate family reductase complex B subunit
HKOGLL_08050 HKOGLL_08050 100.0 Morganella morganii S5 dmsB DMSO/selenate family reductase complex B subunit
HKOGLL_13345 HKOGLL_13345 48.5 Morganella morganii S5 dmsB DMSO/selenate family reductase complex B subunit
F4V73_RS05065 F4V73_RS05065 70.7 Morganella psychrotolerans - DMSO/selenate family reductase complex B subunit
F4V73_RS12920 F4V73_RS12920 94.4 Morganella psychrotolerans - DMSO/selenate family reductase complex B subunit
F4V73_RS14155 F4V73_RS14155 48.5 Morganella psychrotolerans - DMSO/selenate family reductase complex B subunit
PMI_RS00325 PMI_RS00325 33.5 Proteus mirabilis HI4320 - 4Fe-4S dicluster domain-containing protein
PMI_RS00340 PMI_RS00340 33.3 Proteus mirabilis HI4320 - ferredoxin-like protein
PMI_RS00820 PMI_RS00820 44.1 Proteus mirabilis HI4320 - 4Fe-4S dicluster domain-containing protein
PMI_RS05815 PMI_RS05815 71.6 Proteus mirabilis HI4320 dmsB dimethylsulfoxide reductase subunit B
PMI_RS08350 PMI_RS08350 50.5 Proteus mirabilis HI4320 dmsB dimethylsulfoxide reductase subunit B
PMI_RS14660 PMI_RS14660 87.8 Proteus mirabilis HI4320 dmsB dimethylsulfoxide reductase subunit B

Distribution of the homologs in the orthogroup group_21

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_21

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AAJ1 7.45e-68 209 54 2 184 3 ynfG Probable anaerobic dimethyl sulfoxide reductase chain YnfG Escherichia coli (strain K12)
P0AAJ2 7.45e-68 209 54 2 184 3 ynfG Probable anaerobic dimethyl sulfoxide reductase chain YnfG Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q83RZ7 1.3e-66 206 53 2 184 3 dmsB Anaerobic dimethyl sulfoxide reductase chain B Shigella flexneri
P18776 1.37e-66 206 53 2 184 1 dmsB Anaerobic dimethyl sulfoxide reductase chain B Escherichia coli (strain K12)
P45003 8.56e-65 202 48 1 191 3 dmsB Anaerobic dimethyl sulfoxide reductase chain B Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
D3RNN7 4.38e-29 111 36 3 168 1 soeB Sulfite dehydrogenase subunit B Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D)
P44450 1.51e-28 112 34 3 166 3 fdxH Formate dehydrogenase iron-sulfur subunit Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0AAJ7 1.46e-26 106 33 3 166 3 fdoH Formate dehydrogenase-O iron-sulfur subunit Shigella flexneri
P0AAJ5 1.46e-26 106 33 3 166 1 fdoH Formate dehydrogenase-O iron-sulfur subunit Escherichia coli (strain K12)
P0AAJ6 1.46e-26 106 33 3 166 3 fdoH Formate dehydrogenase-O iron-sulfur subunit Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A1I1 2.76e-26 103 39 5 151 1 phsB Thiosulfate reductase electron transfer subunit PhsB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1I2 2.76e-26 103 39 5 151 3 phsB Thiosulfate reductase electron transfer subunit PhsB Salmonella typhi
P0AAJ4 6.61e-26 104 32 3 164 3 fdnH Formate dehydrogenase, nitrate-inducible, iron-sulfur subunit Shigella flexneri
P0AAJ3 6.61e-26 104 32 3 164 1 fdnH Formate dehydrogenase, nitrate-inducible, iron-sulfur subunit Escherichia coli (strain K12)
P31076 9e-26 101 35 6 196 4 psrB Polysulfide reductase chain B Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q7CQM9 2.67e-25 102 36 4 163 1 ttrB Tetrathionate reductase subunit B Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9HR73 9.49e-24 98 33 5 178 2 dmsB Putative dimethyl sulfoxide reductase iron-sulfur subunit B Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
P27273 2.5e-23 95 34 5 178 1 fdhB1 Formate dehydrogenase iron-sulfur subunit Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
O30080 6.36e-23 94 35 5 157 3 ttrB Tetrathionate reductase subunit B Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q727P4 2.33e-22 93 31 4 176 1 DVU_2811 Formate dehydrogenase 2 subunit beta (cytochrome c-553) Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
P0AAK9 5.28e-21 90 35 3 165 3 nrfC Protein NrfC Shigella flexneri
P0AAK7 5.28e-21 90 35 3 165 3 nrfC Protein NrfC Escherichia coli (strain K12)
P0AAK8 5.28e-21 90 35 3 165 3 nrfC Protein NrfC Escherichia coli O157:H7
Q47CW7 2.65e-20 90 28 7 265 1 pcrB Perchlorate reductase subunit beta Dechloromonas aromatica (strain RCB)
P77375 3.64e-20 87 37 5 148 2 ydhX Uncharacterized ferredoxin-like protein YdhX Escherichia coli (strain K12)
Q8X616 7.65e-20 87 37 5 148 3 ydhX Uncharacterized ferredoxin-like protein YdhX Escherichia coli O157:H7
P0AAK0 1.7e-19 88 33 5 179 3 hybA Hydrogenase-2 operon protein HybA Shigella flexneri
P0AAJ8 1.7e-19 88 33 5 179 3 hybA Hydrogenase-2 operon protein HybA Escherichia coli (strain K12)
P0AAJ9 1.7e-19 88 33 5 179 3 hybA Hydrogenase-2 operon protein HybA Escherichia coli O157:H7
Q7WTT9 1.84e-19 86 28 4 212 1 arrB Arsenate respiratory reductase iron-sulfur subunit ArrB Shewanella sp. (strain ANA-3)
P45015 2.19e-18 83 33 2 154 3 nrfC Protein NrfC homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9S1G9 1.09e-17 83 26 7 265 1 serB Selenate reductase subunit beta Thauera selenatis
P60069 7.75e-17 80 26 7 265 1 clrB Chlorate reductase subunit beta Ideonella dechloratans
P19318 2.87e-16 80 30 5 177 1 narY Respiratory nitrate reductase 2 beta chain Escherichia coli (strain K12)
Q83RN5 5.92e-16 79 39 1 99 3 narH Respiratory nitrate reductase 1 beta chain Shigella flexneri
P11349 6.27e-16 79 39 1 99 1 narH Respiratory nitrate reductase 1 beta chain Escherichia coli (strain K12)
Q8GC87 1.11e-15 75 29 6 177 1 fdhB Formate dehydrogenase subunit beta Megalodesulfovibrio gigas (strain ATCC 19364 / DSM 1382 / NCIMB 9332 / VKM B-1759)
P0AAL8 1.13e-15 75 31 3 144 4 ydhY Uncharacterized ferredoxin-like protein YdhY Shigella flexneri
P0AAL6 1.13e-15 75 31 3 144 2 ydhY Uncharacterized ferredoxin-like protein YdhY Escherichia coli (strain K12)
P0AAL7 1.13e-15 75 31 3 144 4 ydhY Uncharacterized ferredoxin-like protein YdhY Escherichia coli O157:H7
P42176 4.16e-15 76 38 1 99 3 narH Nitrate reductase beta chain Bacillus subtilis (strain 168)
Q8GPG3 2.09e-14 73 25 6 233 1 ddhB Dimethylsulfide dehydrogenase subunit beta Rhodovulum sulfidophilum
I3R9M8 2.37e-14 73 26 7 241 1 narH Respiratory nitrate reductase subunit beta Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4)
Q46819 4.59e-14 70 27 5 159 4 ygfS Putative electron transport protein YgfS Escherichia coli (strain K12)
P33389 5.75e-13 70 29 5 178 4 DVU_0535 Protein DVU_0535 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q8L3A9 3.49e-12 68 29 4 147 1 padI NADH-dependent phenylglyoxylate dehydrogenase subunit beta Aromatoleum evansii
O29751 3.51e-12 67 27 9 218 1 hmeA Hdr-like menaquinol oxidoreductase iron-sulfur subunit 1 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q46820 4.1e-12 68 27 8 202 2 uacF Putative oxidoreductase UacF Escherichia coli (strain K12)
Q57713 4.13e-12 65 32 4 125 3 MJ0265 Uncharacterized ferredoxin MJ0265 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P56256 6.83e-12 64 26 5 161 4 ysaA Putative electron transport protein YsaA Escherichia coli (strain K12)
P31894 1.26e-11 64 27 5 167 1 cooF Iron-sulfur protein Rhodospirillum rubrum
Q72E85 1.96e-11 64 30 7 199 1 qrcC Menaquinone reductase, iron-sulfur cluster-binding subunit Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
P85098 2.73e-11 64 32 5 144 1 narH Respiratory nitrate reductase beta chain (Fragments) Bradyrhizobium sp.
P37127 3.82e-11 65 27 5 156 2 aegA Putative oxidoreductase AegA Escherichia coli (strain K12)
P0AAK4 5.32e-09 57 24 6 182 3 hydN Electron transport protein HydN Escherichia coli (strain K12)
P0AAK5 5.32e-09 57 24 6 182 3 hydN Electron transport protein HydN Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AAK6 5.32e-09 57 24 6 182 3 hydN Electron transport protein HydN Escherichia coli O157:H7
P20925 2.03e-08 55 31 5 109 4 None Frd operon probable iron-sulfur subunit A (Fragment) Proteus vulgaris
Q57712 3.8e-08 53 33 3 108 3 MJ0264 Uncharacterized protein MJ0264 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q57619 2.24e-07 52 31 3 97 3 MJ0155 Uncharacterized ferredoxin MJ0155 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P80564 3.33e-07 52 27 6 166 1 bthL Pyrogallol hydroxytransferase small subunit Pelobacter acidigallici
P23481 1.22e-06 50 27 2 102 2 hyfA Hydrogenase-4 component A Escherichia coli (strain K12)
P0AAK3 7.49e-06 48 28 2 110 3 hycB Formate hydrogenlyase subunit 2 Shigella flexneri
P0AAK1 7.49e-06 48 28 2 110 1 hycB Formate hydrogenlyase subunit 2 Escherichia coli (strain K12)
P0AAK2 7.49e-06 48 28 2 110 3 hycB Formate hydrogenlyase subunit 2 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
O27719 7.13e-05 46 34 1 70 4 MTH_1684 Uncharacterized protein MTH_1684 Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q92G41 0.000137 43 35 2 62 3 fdxA Ferredoxin Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q57934 0.000162 45 37 2 79 4 MJ0514 Uncharacterized polyferredoxin-like protein MJ0514 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q50784 0.000221 45 37 2 62 4 mvhB Polyferredoxin protein MvhB Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
P00194 0.000228 41 48 1 41 1 None Ferredoxin-1 Rhodospirillum rubrum
P60232 0.00031 44 37 2 62 1 mvhB Polyferredoxin protein MvhB Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
Q1RH11 0.000327 42 33 2 63 3 fdxA Ferredoxin Rickettsia bellii (strain RML369-C)
P00202 0.000407 40 44 0 43 1 None Ferredoxin Methanosarcina barkeri
Q57652 0.000698 40 43 1 46 3 MJ0199 Uncharacterized ferredoxin MJ0199 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
O58412 0.000717 41 44 1 49 3 vorD Ketoisovalerate oxidoreductase subunit VorD Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q9UYZ0 0.000816 41 44 1 49 3 vorD Ketoisovalerate oxidoreductase subunit VorD Pyrococcus abyssi (strain GE5 / Orsay)
P00195 0.001 39 43 1 41 1 None Ferredoxin Clostridium pasteurianum

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_08500
Feature type CDS
Gene dmsB
Product DMSO/selenate family reductase complex B subunit
Location 9295 - 9936 (strand: -1)
Length 642 (nucleotides) / 213 (amino acids)

Contig

Accession ZDB_365
Length 192330 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_21
Orthogroup size 19
N. genomes 7

Actions

Genomic region

Domains

PF12800 4Fe-4S binding domain
PF13247 4Fe-4S dicluster domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0437 Energy production and conversion (C) C Fe-S-cluster-containing dehydrogenase component (DMSO reductase)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07307 anaerobic dimethyl sulfoxide reductase subunit B Sulfur metabolism
Metabolic pathways
-

Protein Sequence

MSKFIVYPAVSDKQLGFYIDSARCSGCKACQVACKDKNNLDVGRRFRRVYEMTGGGYSRNKNGALINNVFACTLSISCNHCKDPICVRNCPTTAMHKREGDGIVMVNTDKCVGCGACAWSCPYGAPQMNPETKQMSKCDFCIDLQQKGEQPVCVSTCPLGAIQFGPIEELRAKYGSLDYVTGLPDPSITHPNLVINPHQGANFDDMNSERKEK

Flanking regions ( +/- flanking 50bp)

CTCGCCCACGGCAACGCGCACCAGACACTATTAGTTGAGGTGGAAAAAGCATGAGTAAATTCATTGTTTATCCGGCAGTCAGTGACAAACAGTTAGGTTTCTATATTGATTCCGCCCGCTGCTCCGGCTGCAAGGCGTGTCAGGTGGCGTGCAAGGACAAAAATAATCTTGATGTCGGCCGCCGTTTCCGTCGCGTGTATGAAATGACCGGCGGCGGCTACAGCCGCAATAAAAATGGCGCGCTGATTAATAACGTGTTCGCCTGCACGCTCTCCATCTCCTGTAACCACTGCAAAGATCCGATTTGCGTGCGTAACTGCCCGACAACCGCAATGCATAAGCGCGAAGGGGACGGCATTGTGATGGTTAATACCGATAAATGTGTCGGCTGCGGTGCCTGTGCGTGGTCGTGTCCGTACGGCGCACCGCAGATGAATCCGGAAACGAAACAGATGTCGAAATGCGATTTCTGTATTGATCTTCAGCAGAAAGGTGAGCAGCCGGTATGTGTCAGCACCTGTCCGCTCGGGGCGATTCAGTTCGGACCAATTGAGGAACTGCGGGCGAAATACGGCTCACTCGATTACGTGACAGGTTTGCCGGATCCGTCAATCACGCATCCGAATCTGGTGATCAATCCGCATCAGGGCGCAAATTTTGATGACATGAACAGTGAGAGAAAAGAAAAATGAATGAGTGGTCACTTTTAATTTTCACTTACATGATGAATGCGGCGGCTGGG