Homologs in group_3731

Help

1 homologs were identified in 1 genome with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
F4V73_RS05065 F4V73_RS05065 87.1 Morganella psychrotolerans - DMSO/selenate family reductase complex B subunit

Distribution of the homologs in the orthogroup group_3731

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3731

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AAJ1 1.55e-71 219 55 2 192 3 ynfG Probable anaerobic dimethyl sulfoxide reductase chain YnfG Escherichia coli (strain K12)
P0AAJ2 1.55e-71 219 55 2 192 3 ynfG Probable anaerobic dimethyl sulfoxide reductase chain YnfG Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P18776 3.4e-71 218 55 2 192 1 dmsB Anaerobic dimethyl sulfoxide reductase chain B Escherichia coli (strain K12)
Q83RZ7 3.48e-71 218 55 2 192 3 dmsB Anaerobic dimethyl sulfoxide reductase chain B Shigella flexneri
P45003 3.3e-66 205 50 1 193 3 dmsB Anaerobic dimethyl sulfoxide reductase chain B Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
D3RNN7 6.63e-33 121 40 3 168 1 soeB Sulfite dehydrogenase subunit B Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D)
P0A1I1 5.68e-31 115 40 5 158 1 phsB Thiosulfate reductase electron transfer subunit PhsB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1I2 5.68e-31 115 40 5 158 3 phsB Thiosulfate reductase electron transfer subunit PhsB Salmonella typhi
P0AAJ4 1.62e-27 108 36 3 164 3 fdnH Formate dehydrogenase, nitrate-inducible, iron-sulfur subunit Shigella flexneri
P0AAJ3 1.62e-27 108 36 3 164 1 fdnH Formate dehydrogenase, nitrate-inducible, iron-sulfur subunit Escherichia coli (strain K12)
P44450 6.59e-27 107 34 3 166 3 fdxH Formate dehydrogenase iron-sulfur subunit Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q7CQM9 1.24e-26 105 37 3 167 1 ttrB Tetrathionate reductase subunit B Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0AAJ7 1.38e-26 106 34 4 173 3 fdoH Formate dehydrogenase-O iron-sulfur subunit Shigella flexneri
P0AAJ5 1.38e-26 106 34 4 173 1 fdoH Formate dehydrogenase-O iron-sulfur subunit Escherichia coli (strain K12)
P0AAJ6 1.38e-26 106 34 4 173 3 fdoH Formate dehydrogenase-O iron-sulfur subunit Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q9HR73 2.11e-26 105 35 5 176 2 dmsB Putative dimethyl sulfoxide reductase iron-sulfur subunit B Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
P31076 7.79e-26 101 34 7 201 4 psrB Polysulfide reductase chain B Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
O30080 1.5e-25 101 37 5 161 3 ttrB Tetrathionate reductase subunit B Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
P27273 2.53e-25 100 33 4 177 1 fdhB1 Formate dehydrogenase iron-sulfur subunit Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
P0AAK0 4.9e-24 100 35 5 179 3 hybA Hydrogenase-2 operon protein HybA Shigella flexneri
P0AAJ8 4.9e-24 100 35 5 179 3 hybA Hydrogenase-2 operon protein HybA Escherichia coli (strain K12)
P0AAJ9 4.9e-24 100 35 5 179 3 hybA Hydrogenase-2 operon protein HybA Escherichia coli O157:H7
P77375 4.03e-23 95 39 4 148 2 ydhX Uncharacterized ferredoxin-like protein YdhX Escherichia coli (strain K12)
P0AAK9 8.01e-23 94 35 2 165 3 nrfC Protein NrfC Shigella flexneri
P0AAK7 8.01e-23 94 35 2 165 3 nrfC Protein NrfC Escherichia coli (strain K12)
P0AAK8 8.01e-23 94 35 2 165 3 nrfC Protein NrfC Escherichia coli O157:H7
Q8X616 9.79e-23 94 39 4 148 3 ydhX Uncharacterized ferredoxin-like protein YdhX Escherichia coli O157:H7
P60069 2.4e-22 95 28 7 266 1 clrB Chlorate reductase subunit beta Ideonella dechloratans
Q9S1G9 3.76e-22 95 28 7 265 1 serB Selenate reductase subunit beta Thauera selenatis
P45015 1.79e-21 91 35 3 166 3 nrfC Protein NrfC homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q7WTT9 2.08e-21 91 29 6 236 1 arrB Arsenate respiratory reductase iron-sulfur subunit ArrB Shewanella sp. (strain ANA-3)
P33389 1.05e-20 91 33 5 188 4 DVU_0535 Protein DVU_0535 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
O29751 7.31e-20 87 31 9 235 1 hmeA Hdr-like menaquinol oxidoreductase iron-sulfur subunit 1 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q47CW7 1.17e-19 88 28 7 253 1 pcrB Perchlorate reductase subunit beta Dechloromonas aromatica (strain RCB)
Q727P4 3.94e-17 79 26 3 172 1 DVU_2811 Formate dehydrogenase 2 subunit beta (cytochrome c-553) Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
P0AAL8 2.02e-16 77 30 2 155 4 ydhY Uncharacterized ferredoxin-like protein YdhY Shigella flexneri
P0AAL6 2.02e-16 77 30 2 155 2 ydhY Uncharacterized ferredoxin-like protein YdhY Escherichia coli (strain K12)
P0AAL7 2.02e-16 77 30 2 155 4 ydhY Uncharacterized ferredoxin-like protein YdhY Escherichia coli O157:H7
I3R9M8 3.27e-16 79 26 8 263 1 narH Respiratory nitrate reductase subunit beta Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4)
P42176 3.35e-16 79 30 3 179 3 narH Nitrate reductase beta chain Bacillus subtilis (strain 168)
Q8GPG3 6.11e-16 78 27 7 248 1 ddhB Dimethylsulfide dehydrogenase subunit beta Rhodovulum sulfidophilum
P19318 7.81e-16 78 41 1 95 1 narY Respiratory nitrate reductase 2 beta chain Escherichia coli (strain K12)
P11349 2.75e-15 77 40 1 93 1 narH Respiratory nitrate reductase 1 beta chain Escherichia coli (strain K12)
Q83RN5 2.8e-15 77 40 1 93 3 narH Respiratory nitrate reductase 1 beta chain Shigella flexneri
Q72E85 8.12e-15 73 27 7 226 1 qrcC Menaquinone reductase, iron-sulfur cluster-binding subunit Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q8L3A9 1.69e-14 74 31 4 147 1 padI NADH-dependent phenylglyoxylate dehydrogenase subunit beta Aromatoleum evansii
Q8GC87 2.78e-14 72 26 7 200 1 fdhB Formate dehydrogenase subunit beta Megalodesulfovibrio gigas (strain ATCC 19364 / DSM 1382 / NCIMB 9332 / VKM B-1759)
Q46819 3.77e-14 70 27 6 159 4 ygfS Putative electron transport protein YgfS Escherichia coli (strain K12)
Q46820 2.7e-13 71 30 6 156 2 uacF Putative oxidoreductase UacF Escherichia coli (strain K12)
P31894 1.31e-12 67 28 7 183 1 cooF Iron-sulfur protein Rhodospirillum rubrum
P56256 1.57e-11 63 25 5 164 4 ysaA Putative electron transport protein YsaA Escherichia coli (strain K12)
P37127 3.51e-10 62 27 6 155 2 aegA Putative oxidoreductase AegA Escherichia coli (strain K12)
P85098 5.87e-10 60 29 5 144 1 narH Respiratory nitrate reductase beta chain (Fragments) Bradyrhizobium sp.
P0AAK4 6.1e-09 56 26 7 182 3 hydN Electron transport protein HydN Escherichia coli (strain K12)
P0AAK5 6.1e-09 56 26 7 182 3 hydN Electron transport protein HydN Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AAK6 6.1e-09 56 26 7 182 3 hydN Electron transport protein HydN Escherichia coli O157:H7
Q57713 1.22e-08 55 29 8 165 3 MJ0265 Uncharacterized ferredoxin MJ0265 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P23481 2.66e-08 55 25 7 178 2 hyfA Hydrogenase-4 component A Escherichia coli (strain K12)
P80564 2.12e-07 53 26 8 201 1 bthL Pyrogallol hydroxytransferase small subunit Pelobacter acidigallici
Q57619 5.79e-07 50 32 3 89 3 MJ0155 Uncharacterized ferredoxin MJ0155 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P20925 9.02e-07 50 33 6 109 4 None Frd operon probable iron-sulfur subunit A (Fragment) Proteus vulgaris
Q57712 1.34e-06 49 36 3 87 3 MJ0264 Uncharacterized protein MJ0264 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P0AAK3 4.42e-06 48 29 3 110 3 hycB Formate hydrogenlyase subunit 2 Shigella flexneri
P0AAK1 4.42e-06 48 29 3 110 1 hycB Formate hydrogenlyase subunit 2 Escherichia coli (strain K12)
P0AAK2 4.42e-06 48 29 3 110 3 hycB Formate hydrogenlyase subunit 2 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
O27719 0.000291 44 35 1 60 4 MTH_1684 Uncharacterized protein MTH_1684 Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
P00195 0.000311 40 38 2 57 1 None Ferredoxin Clostridium pasteurianum

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS05815
Feature type CDS
Gene dmsB
Product dimethylsulfoxide reductase subunit B
Location 1273028 - 1273657 (strand: 1)
Length 630 (nucleotides) / 209 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_3731
Orthogroup size 2
N. genomes 2

Actions

Genomic region

Domains

PF13247 4Fe-4S dicluster domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0437 Energy production and conversion (C) C Fe-S-cluster-containing dehydrogenase component (DMSO reductase)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07307 anaerobic dimethyl sulfoxide reductase subunit B Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
-

Protein Sequence

MSEFKQYAPVSDEQLGFFIDSSRCSGCKACQVACKDKNNLEVGRRFRRIYEIQGGGFAPNGQGAFENNVFAYTLTISCNHCNDPICVKNCPTTAMHKRPGDGIVRVDTSKCVGCGYCSWSCPYGAPQMNTETGQMSKCDFCVDLLAEGKNPICVDTCPLNAIKFGKIKDLRAKYGHLSQVQGLPDFTITHPNLVIKPHTGAIKKGGNQA

Flanking regions ( +/- flanking 50bp)

TTAGCCCATGGTAATTCACATTTAACCGTTTTAGTTGAGGTAACCAAAGCATGAGTGAATTCAAACAATATGCGCCTGTTAGCGATGAACAGCTTGGTTTTTTTATTGATTCTTCTCGTTGCTCAGGTTGTAAAGCATGCCAAGTTGCATGTAAAGATAAAAATAATTTAGAGGTTGGGCGCCGTTTTCGCCGTATTTATGAAATACAGGGCGGGGGATTTGCGCCTAATGGGCAAGGTGCATTTGAAAATAATGTCTTTGCATACACATTAACGATTTCATGTAATCACTGTAACGATCCTATATGTGTAAAAAACTGTCCAACAACAGCAATGCATAAACGCCCCGGGGATGGCATTGTCCGTGTTGATACCAGCAAATGTGTTGGGTGTGGTTATTGCTCATGGTCATGTCCTTATGGTGCACCACAAATGAATACTGAAACGGGACAAATGTCGAAATGTGATTTCTGCGTAGATTTATTAGCAGAAGGTAAAAATCCTATTTGTGTTGATACATGTCCATTAAATGCGATTAAGTTTGGAAAAATTAAAGATCTACGCGCTAAATATGGTCATTTAAGCCAAGTTCAAGGGTTACCTGATTTTACAATCACTCACCCTAATTTGGTCATTAAACCACATACTGGTGCAATTAAAAAAGGAGGGAACCAAGCATGAGTGAATGGCCATTAGTTACCTTTACTTTGTTAGTACAAAGTTCTGTTGGT