Homologs in group_21

Help

18 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08075 FBDBKF_08075 44.1 Morganella morganii S1 dmsB DMSO/selenate family reductase complex B subunit
FBDBKF_10455 FBDBKF_10455 45.5 Morganella morganii S1 dmsB DMSO/selenate family reductase complex B subunit
EHELCC_13905 EHELCC_13905 44.1 Morganella morganii S2 dmsB DMSO/selenate family reductase complex B subunit
EHELCC_14790 EHELCC_14790 45.5 Morganella morganii S2 dmsB DMSO/selenate family reductase complex B subunit
NLDBIP_14350 NLDBIP_14350 44.1 Morganella morganii S4 dmsB DMSO/selenate family reductase complex B subunit
NLDBIP_14620 NLDBIP_14620 45.5 Morganella morganii S4 dmsB DMSO/selenate family reductase complex B subunit
LHKJJB_08500 LHKJJB_08500 44.1 Morganella morganii S3 dmsB DMSO/selenate family reductase complex B subunit
LHKJJB_14725 LHKJJB_14725 45.5 Morganella morganii S3 dmsB DMSO/selenate family reductase complex B subunit
HKOGLL_08050 HKOGLL_08050 44.1 Morganella morganii S5 dmsB DMSO/selenate family reductase complex B subunit
HKOGLL_13345 HKOGLL_13345 45.5 Morganella morganii S5 dmsB DMSO/selenate family reductase complex B subunit
F4V73_RS05065 F4V73_RS05065 44.1 Morganella psychrotolerans - DMSO/selenate family reductase complex B subunit
F4V73_RS12920 F4V73_RS12920 43.0 Morganella psychrotolerans - DMSO/selenate family reductase complex B subunit
F4V73_RS14155 F4V73_RS14155 46.1 Morganella psychrotolerans - DMSO/selenate family reductase complex B subunit
PMI_RS00325 PMI_RS00325 31.8 Proteus mirabilis HI4320 - 4Fe-4S dicluster domain-containing protein
PMI_RS00340 PMI_RS00340 33.1 Proteus mirabilis HI4320 - ferredoxin-like protein
PMI_RS05815 PMI_RS05815 44.7 Proteus mirabilis HI4320 dmsB dimethylsulfoxide reductase subunit B
PMI_RS08350 PMI_RS08350 41.2 Proteus mirabilis HI4320 dmsB dimethylsulfoxide reductase subunit B
PMI_RS14660 PMI_RS14660 44.1 Proteus mirabilis HI4320 dmsB dimethylsulfoxide reductase subunit B

Distribution of the homologs in the orthogroup group_21

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_21

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AAJ1 2.55e-50 164 48 4 184 3 ynfG Probable anaerobic dimethyl sulfoxide reductase chain YnfG Escherichia coli (strain K12)
P0AAJ2 2.55e-50 164 48 4 184 3 ynfG Probable anaerobic dimethyl sulfoxide reductase chain YnfG Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q83RZ7 6.39e-49 160 46 4 184 3 dmsB Anaerobic dimethyl sulfoxide reductase chain B Shigella flexneri
P18776 7.2e-49 160 46 4 184 1 dmsB Anaerobic dimethyl sulfoxide reductase chain B Escherichia coli (strain K12)
P45003 2.26e-44 149 40 2 186 3 dmsB Anaerobic dimethyl sulfoxide reductase chain B Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
O30080 2.79e-35 125 39 3 169 3 ttrB Tetrathionate reductase subunit B Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q7CQM9 3.62e-34 124 34 4 189 1 ttrB Tetrathionate reductase subunit B Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9HR73 1.56e-30 115 36 3 175 2 dmsB Putative dimethyl sulfoxide reductase iron-sulfur subunit B Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
P0A1I1 7.02e-30 111 36 4 166 1 phsB Thiosulfate reductase electron transfer subunit PhsB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1I2 7.02e-30 111 36 4 166 3 phsB Thiosulfate reductase electron transfer subunit PhsB Salmonella typhi
P31076 5.58e-29 108 37 6 185 4 psrB Polysulfide reductase chain B Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
P27273 3.72e-26 102 35 2 164 1 fdhB1 Formate dehydrogenase iron-sulfur subunit Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
P44450 8.89e-26 103 36 4 169 3 fdxH Formate dehydrogenase iron-sulfur subunit Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q7WTT9 1.13e-25 101 28 5 225 1 arrB Arsenate respiratory reductase iron-sulfur subunit ArrB Shewanella sp. (strain ANA-3)
P0AAK9 2.86e-25 100 36 6 180 3 nrfC Protein NrfC Shigella flexneri
P0AAK7 2.86e-25 100 36 6 180 3 nrfC Protein NrfC Escherichia coli (strain K12)
P0AAK8 2.86e-25 100 36 6 180 3 nrfC Protein NrfC Escherichia coli O157:H7
P33389 4.39e-25 102 35 3 168 4 DVU_0535 Protein DVU_0535 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
D3RNN7 4.45e-25 100 35 5 168 1 soeB Sulfite dehydrogenase subunit B Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D)
P45015 4.48e-25 99 36 4 150 3 nrfC Protein NrfC homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0AAJ4 1.57e-24 100 34 5 181 3 fdnH Formate dehydrogenase, nitrate-inducible, iron-sulfur subunit Shigella flexneri
P0AAJ3 1.57e-24 100 34 5 181 1 fdnH Formate dehydrogenase, nitrate-inducible, iron-sulfur subunit Escherichia coli (strain K12)
P0AAJ7 3.31e-24 99 31 2 180 3 fdoH Formate dehydrogenase-O iron-sulfur subunit Shigella flexneri
P0AAJ5 3.31e-24 99 31 2 180 1 fdoH Formate dehydrogenase-O iron-sulfur subunit Escherichia coli (strain K12)
P0AAJ6 3.31e-24 99 31 2 180 3 fdoH Formate dehydrogenase-O iron-sulfur subunit Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AAK0 4.1e-23 96 34 7 195 3 hybA Hydrogenase-2 operon protein HybA Shigella flexneri
P0AAJ8 4.1e-23 96 34 7 195 3 hybA Hydrogenase-2 operon protein HybA Escherichia coli (strain K12)
P0AAJ9 4.1e-23 96 34 7 195 3 hybA Hydrogenase-2 operon protein HybA Escherichia coli O157:H7
P77375 1.43e-22 93 31 6 189 2 ydhX Uncharacterized ferredoxin-like protein YdhX Escherichia coli (strain K12)
Q8X616 4.07e-22 92 33 4 164 3 ydhX Uncharacterized ferredoxin-like protein YdhX Escherichia coli O157:H7
Q47CW7 8.62e-21 90 41 1 101 1 pcrB Perchlorate reductase subunit beta Dechloromonas aromatica (strain RCB)
O29751 2.28e-20 88 36 6 163 1 hmeA Hdr-like menaquinol oxidoreductase iron-sulfur subunit 1 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q727P4 2.28e-20 87 29 6 204 1 DVU_2811 Formate dehydrogenase 2 subunit beta (cytochrome c-553) Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q46819 8.6e-18 79 33 7 159 4 ygfS Putative electron transport protein YgfS Escherichia coli (strain K12)
P60069 8.67e-18 82 34 6 143 1 clrB Chlorate reductase subunit beta Ideonella dechloratans
Q9S1G9 2.32e-16 78 31 6 147 1 serB Selenate reductase subunit beta Thauera selenatis
Q72E85 3.18e-16 77 29 9 217 1 qrcC Menaquinone reductase, iron-sulfur cluster-binding subunit Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q8GC87 3.92e-16 76 28 7 190 1 fdhB Formate dehydrogenase subunit beta Megalodesulfovibrio gigas (strain ATCC 19364 / DSM 1382 / NCIMB 9332 / VKM B-1759)
P56256 8.84e-16 73 29 6 155 4 ysaA Putative electron transport protein YsaA Escherichia coli (strain K12)
P0AAL8 1.96e-15 74 27 4 157 4 ydhY Uncharacterized ferredoxin-like protein YdhY Shigella flexneri
P0AAL6 1.96e-15 74 27 4 157 2 ydhY Uncharacterized ferredoxin-like protein YdhY Escherichia coli (strain K12)
P0AAL7 1.96e-15 74 27 4 157 4 ydhY Uncharacterized ferredoxin-like protein YdhY Escherichia coli O157:H7
Q8GPG3 1.8e-14 73 37 5 114 1 ddhB Dimethylsulfide dehydrogenase subunit beta Rhodovulum sulfidophilum
P11349 3.5e-14 73 39 2 92 1 narH Respiratory nitrate reductase 1 beta chain Escherichia coli (strain K12)
Q83RN5 3.54e-14 73 39 2 92 3 narH Respiratory nitrate reductase 1 beta chain Shigella flexneri
Q8L3A9 3.86e-14 72 26 5 200 1 padI NADH-dependent phenylglyoxylate dehydrogenase subunit beta Aromatoleum evansii
P19318 6.23e-14 72 38 2 92 1 narY Respiratory nitrate reductase 2 beta chain Escherichia coli (strain K12)
Q57712 2.15e-13 67 33 6 148 3 MJ0264 Uncharacterized protein MJ0264 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P37127 2.71e-13 70 30 6 146 2 aegA Putative oxidoreductase AegA Escherichia coli (strain K12)
Q46820 9.18e-13 68 30 5 141 2 uacF Putative oxidoreductase UacF Escherichia coli (strain K12)
I3R9M8 2.13e-12 67 34 4 111 1 narH Respiratory nitrate reductase subunit beta Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4)
P0AAK4 2.99e-11 62 29 8 179 3 hydN Electron transport protein HydN Escherichia coli (strain K12)
P0AAK5 2.99e-11 62 29 8 179 3 hydN Electron transport protein HydN Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AAK6 2.99e-11 62 29 8 179 3 hydN Electron transport protein HydN Escherichia coli O157:H7
P42176 5.45e-11 63 32 2 92 3 narH Nitrate reductase beta chain Bacillus subtilis (strain 168)
P31894 9.14e-11 61 28 6 165 1 cooF Iron-sulfur protein Rhodospirillum rubrum
P85098 3.67e-10 60 31 5 134 1 narH Respiratory nitrate reductase beta chain (Fragments) Bradyrhizobium sp.
Q57713 3.74e-10 59 28 5 142 3 MJ0265 Uncharacterized ferredoxin MJ0265 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P20925 3.2e-09 56 34 6 113 4 None Frd operon probable iron-sulfur subunit A (Fragment) Proteus vulgaris
P80564 1.5e-08 56 28 5 156 1 bthL Pyrogallol hydroxytransferase small subunit Pelobacter acidigallici
P0AAK3 1.93e-08 55 26 6 175 3 hycB Formate hydrogenlyase subunit 2 Shigella flexneri
P0AAK1 1.93e-08 55 26 6 175 1 hycB Formate hydrogenlyase subunit 2 Escherichia coli (strain K12)
P0AAK2 1.93e-08 55 26 6 175 3 hycB Formate hydrogenlyase subunit 2 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P23481 5.42e-08 53 25 8 177 2 hyfA Hydrogenase-4 component A Escherichia coli (strain K12)
Q57619 9.79e-08 52 29 5 142 3 MJ0155 Uncharacterized ferredoxin MJ0155 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q5N5L9 3.52e-05 45 34 4 108 3 ndhI NAD(P)H-quinone oxidoreductase subunit I Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31NJ5 3.52e-05 45 34 4 108 3 ndhI NAD(P)H-quinone oxidoreductase subunit I Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q00388 3.6e-05 46 30 3 97 4 vhuB Polyferredoxin protein VhuB Methanococcus voltae
A2BNV4 6.79e-05 45 37 2 78 3 ndhI NAD(P)H-quinone oxidoreductase subunit I Prochlorococcus marinus (strain AS9601)
Q31D22 6.79e-05 45 37 2 78 3 ndhI NAD(P)H-quinone oxidoreductase subunit I Prochlorococcus marinus (strain MIT 9312)
A3PAM7 7.05e-05 45 37 2 78 3 ndhI NAD(P)H-quinone oxidoreductase subunit I Prochlorococcus marinus (strain MIT 9301)
A8G2G5 7.26e-05 45 37 2 78 3 ndhI NAD(P)H-quinone oxidoreductase subunit I Prochlorococcus marinus (strain MIT 9215)
Q7VE31 7.64e-05 45 26 5 136 3 ndhI NAD(P)H-quinone oxidoreductase subunit I Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Q46HL4 8.44e-05 45 34 4 96 3 ndhI NAD(P)H-quinone oxidoreductase subunit I Prochlorococcus marinus (strain NATL2A)
A2BZY6 9.11e-05 45 34 4 96 3 ndhI NAD(P)H-quinone oxidoreductase subunit I Prochlorococcus marinus (strain NATL1A)
A2BUD6 9.25e-05 44 37 2 78 3 ndhI NAD(P)H-quinone oxidoreductase subunit I Prochlorococcus marinus (strain MIT 9515)
Q7TUH1 0.000103 44 37 2 78 3 ndhI NAD(P)H-quinone oxidoreductase subunit I Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Q3B074 0.000106 44 35 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I Synechococcus sp. (strain CC9902)
Q8HVR6 0.000109 44 32 2 82 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Hofmeisteria fasciculata
A9BD19 0.000118 44 37 2 78 3 ndhI NAD(P)H-quinone oxidoreductase subunit I Prochlorococcus marinus (strain MIT 9211)
Q0I6W0 0.00012 44 34 4 96 3 ndhI NAD(P)H-quinone oxidoreductase subunit I Synechococcus sp. (strain CC9311)
Q7TUL5 0.000126 44 34 4 96 3 ndhI NAD(P)H-quinone oxidoreductase subunit I Prochlorococcus marinus (strain MIT 9313)
Q5SCZ1 0.000128 44 34 2 78 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Huperzia lucidula
A2CD59 0.000143 44 34 4 96 3 ndhI NAD(P)H-quinone oxidoreductase subunit I Prochlorococcus marinus (strain MIT 9303)
Q3AGY9 0.000146 44 34 4 96 3 ndhI NAD(P)H-quinone oxidoreductase subunit I Synechococcus sp. (strain CC9605)
Q7U403 0.000151 44 34 4 96 3 ndhI NAD(P)H-quinone oxidoreductase subunit I Parasynechococcus marenigrum (strain WH8102)
A5GP51 0.000169 44 34 4 96 3 ndhI NAD(P)H-quinone oxidoreductase subunit I Synechococcus sp. (strain WH7803)
Q9M3I7 0.000173 43 32 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Spinacia oleracea
Q8M9T7 0.000249 43 25 5 134 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Chaetosphaeridium globosum
A4GGF0 0.000264 43 29 3 91 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Phaseolus vulgaris
Q32S03 0.000351 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Staurastrum punctulatum
Q8HVM1 0.000385 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Raillardella argentea
Q8HVT3 0.000385 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Eatonella nivea
A4GYX0 0.0004 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Populus trichocarpa
Q3M9K8 0.000401 42 32 4 107 3 ndhI NAD(P)H-quinone oxidoreductase subunit I Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q14FA4 0.000441 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Populus alba
Q8HVK0 0.000445 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Tridax balbisioides
Q0G9Q8 0.000449 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Daucus carota
Q9WWM6 0.000464 42 32 4 107 3 ndhI NAD(P)H-quinone oxidoreductase subunit I Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q8HVN1 0.000468 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Perymeniopsis ovalifolia
Q57934 0.00047 43 29 7 147 4 MJ0514 Uncharacterized polyferredoxin-like protein MJ0514 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q0ZIW4 0.000473 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Vitis vinifera
Q8HVP6 0.000486 42 31 3 89 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Melampodium leucanthum
Q9BBP0 0.000494 42 32 2 78 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Lotus japonicus
Q8HVK8 0.000496 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Steiractinia sodiroi
Q8HVJ7 0.000506 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Venegasia carpesioides
Q8HVM3 0.000506 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Pseudoclappia arenaria
Q8HVM7 0.000506 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Philactis zinnioides
Q8HVN8 0.000506 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Oteiza scandens
Q8HVQ3 0.000506 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Monolopia congdonii
Q8HVQ0 0.000506 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Loxothysanus sinuatus
Q8HVQ4 0.000506 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Layia heterotricha
Q8HVQ8 0.000506 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Jaumea carnosa
Q8HVQ9 0.000506 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Jaegeria hirta
Q8HVR4 0.000506 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Hymenopappus filifolius var. filifolius
Q8HVR9 0.000506 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Guardiola tulocarpus
Q8HVS9 0.000506 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Eriophyllum staechadifolium
Q8HVS7 0.000506 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Eriophyllum congdonii
Q8HVT1 0.000506 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Engelmannia peristenia
Q8HVU8 0.000506 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Chaetymenia peduncularis
Q8HVW2 0.000506 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Acmella radicans
Q00236 0.000511 42 32 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I Leptolyngbya boryana
Q8HVL3 0.000511 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Silphium perfoliatum
Q8HVM2 0.000511 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Psilostrophe gnaphalodes
Q8HVP7 0.000511 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Marshallia caespitosa
Q332S3 0.000511 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Lactuca sativa
Q8HVR3 0.000511 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Hymenoxys lemmonii
Q8HVR8 0.000511 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Helenium bigelovii
Q8HVK6 0.000516 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Synedrella nodiflora
Q8HVN4 0.000516 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Parthenium hysterophorus
Q8HVQ5 0.000516 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Lasianthaea macrocephala
Q8HVT2 0.000516 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Encelia californica
Q8HVU0 0.000516 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Delilia biflora
Q8HVU1 0.000516 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Damnxanthodium calvum
Q8HVV0 0.000516 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Calyptocarpus vialis
Q8HVM5 0.000521 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Polymnia canadensis
Q32RK1 0.000523 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Zygnema circumcarinatum
Q8HVU9 0.000526 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Chaenactis santolinoides
A6MMQ9 0.000529 42 33 2 78 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Dioscorea elephantipes
Q8HVJ9 0.000531 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Trigonospermum melampodioides
Q8HVL4 0.000531 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Sigesbeckia blakei
Q8HVL9 0.000531 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Riencourtia oblongifolia
Q8HVP4 0.000531 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Milleria quinqueflora
Q2QD37 0.000534 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Cucumis sativus
Q8HVQ2 0.000536 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Trilisa paniculata
Q8HVK7 0.000536 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Stevia rebaudiana
Q8HVV4 0.000536 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Picradeniopsis absinthifolia
Q8HVN2 0.000536 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Laphamia lindheimeri
Q8HVJ5 0.000536 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Bahiopsis tomentosa
Q8HVI9 0.000542 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Zinnia juniperifolia
Q8HVJ1 0.000542 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Zaluzania megacephala
Q8HVJ4 0.000542 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Villanova achilleoides
Q8HVJ6 0.000542 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Verbesina jacksonii
Q8HVJ8 0.000542 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Varilla mexicana
Q8HVT4 0.000542 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Thymophylla tenuiloba
Q8HVK3 0.000542 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Tetragonotheca repanda
Q8HVK4 0.000542 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Tetrachyron orizabensis
Q8HVK5 0.000542 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Tagetes erecta
Q8HVK9 0.000542 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Squamopappus skutchii
Q8HVL0 0.000542 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Spilanthes urens
Q8HVL2 0.000542 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Smallanthus microcephalus
Q8HVL5 0.000542 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Rumfordia penninervis
Q8HVL6 0.000542 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Rudbeckia hirta
Q8HVL7 0.000542 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Rojasianthe superba
Q8HVM0 0.000542 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Ratibida columnifera
Q8HVM4 0.000542 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Psathyrotes annua
Q8HVM6 0.000542 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Podachaenium eminens
Q8HVM8 0.000542 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Phaneroglossa bolusii
Q8HVM9 0.000542 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Peucephyllum schottii
Q8HVN3 0.000542 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Pericome caudata
Q8HVR0 0.000542 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Pentanema britannicum
Q8HVP0 0.000542 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Neurolaena lobata
Q8HVP1 0.000542 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Montanoa revealii
Q8HVP3 0.000542 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Monactis pallatangensis
Q8HVP2 0.000542 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Monolopia gracilens
Q8HVP8 0.000542 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Madia sativa
Q8HVQ6 0.000542 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Lagophylla ramosissima
Q8HVQ7 0.000542 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Kingianthus paradoxus
Q8HVR1 0.000542 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Idiopappus quitensis
Q8HVR2 0.000542 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Ichthyothere terminalis
Q8HVR7 0.000542 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Helianthus annuus
Q8HVS0 0.000542 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Greenmaniella resinosa
Q8HVS1 0.000542 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Galinsoga quadriradiata
Q8HVS2 0.000542 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Galeana pratensis
Q8HVS3 0.000542 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Florestina pedata
Q8HVS4 0.000542 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Flaveria ramosissima
Q8HVS5 0.000542 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Eutetras palmeri
Q8HVT5 0.000542 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Dyscritothamnus mirandae
Q8HVT6 0.000542 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Dugesia mexicana
Q8HVT9 0.000542 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Desmanthodium fruticosum
Q8HVU2 0.000542 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Dahlia coccinea
Q8HVU3 0.000542 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Cymophora venezuelensis
Q8HVS8 0.000542 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Constancea nevinii
Q8HVU6 0.000542 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Chromolepis heterophylla
Q8HVV2 0.000542 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Blepharispermum zanguebaricum
Q8HVV3 0.000542 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Bebbia juncea
Q8HVV5 0.000542 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Athroisma gracile subsp. psyllioides
Q8HVV6 0.000542 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Arnica mollis
Q8HVJ2 0.000542 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Arnica dealbata
Q8HVV7 0.000542 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Aphanactis jamesoniana
Q8HVW3 0.000542 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Acanthospermum australe
Q06R76 0.000542 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Jasminum nudiflorum
Q7I7Y4 0.000547 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Zexmenia serrata
Q8HVJ0 0.000547 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Wedelia tegetis
Q8HVJ3 0.000547 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Tilesia baccata
Q8HVK2 0.000547 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Sphagneticola trilobata
Q8HVL1 0.000547 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Perymenium macrocephalum
Q8HVN7 0.000547 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Oxypappus scaber
Q8HVN6 0.000547 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Melanthera nivea
Q8HVP9 0.000547 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Melanthera integrifolia
Q8HVP5 0.000547 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Lundellianthus jaliscensis
Q8HVQ1 0.000547 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Eclipta prostrata
Q8HVT7 0.000547 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Dimerostemma vestitum
Q8HVU4 0.000547 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Coreopsis petrophiloides
Q8HVU5 0.000547 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Clibadium alatum
Q8HVV1 0.000547 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Calea megacephala
A1XGT7 0.00055 42 33 2 78 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Ranunculus macranthus
Q8HVV8 0.000552 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Ambrosia trifida
Q8HVN5 0.000558 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Palafoxia arida
Q8HVT8 0.000558 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Dimeresia howellii
Q8HVS6 0.000569 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Espeletia timotensis
Q8HVU7 0.000569 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Chamaechaenactis scaposa
A4QL75 0.000569 42 33 2 74 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Draba nemorosa
P06252 0.000575 42 31 3 88 1 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Nicotiana tabacum
Q33BW8 0.000575 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Nicotiana tomentosiformis
Q3C1Q0 0.000575 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Nicotiana sylvestris
Q7FNR7 0.000575 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Atropa belladonna
Q8HVL8 0.00058 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Rensonia salvadorica
Q8HVR5 0.00058 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Hulsea algida
A4QJY6 0.00058 42 33 2 74 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Olimarabidopsis pumila
A4QK74 0.00058 42 33 2 74 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Arabis hirsuta
Q2VEC7 0.000586 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Solanum tuberosum
Q2MI46 0.000586 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Solanum lycopersicum
Q2MID3 0.000586 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Solanum bulbocastanum
A4QLY9 0.000598 42 33 2 74 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Nasturtium officinale
Q9MTH8 0.000615 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Oenothera elata subsp. hookeri
Q8HVN9 0.000615 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Oblivia mikanioides
P56755 0.000621 42 33 2 74 1 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Arabidopsis thaliana
A4QKP9 0.000634 42 33 2 74 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Capsella bursa-pastoris
A4QLQ1 0.000634 42 33 2 74 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Lobularia maritima
Q8HVT0 0.00064 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Enydra sessilis
A4QLG3 0.00064 42 33 2 74 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Lepidium virginicum
A6MM91 0.000653 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Buxus microphylla
Q06GK9 0.000655 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Piper cenocladum
A4QKG1 0.000659 42 33 2 74 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Barbarea verna
A4QKY8 0.000665 42 33 2 74 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Crucihimalaya wallichii
Q2PMN6 0.000671 42 30 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Glycine max
Q68RV2 0.000672 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Panax ginseng
A4QJQ4 0.000679 42 33 2 74 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Aethionema grandiflorum
Q09FQ6 0.00068 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Nandina domestica
Q9TKV4 0.000691 42 33 2 78 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Nephroselmis olivacea
Q49KU4 0.000719 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Eucalyptus globulus subsp. globulus
A6MMZ9 0.000779 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Illicium oligandrum
Q2L959 0.000801 41 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Gossypium hirsutum
A0ZZ89 0.000801 41 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Gossypium barbadense
Q09WW4 0.000817 41 32 3 87 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Morus indica
Q0G9G5 0.000818 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Liriodendron tulipifera
Q6EVZ6 0.000843 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Nymphaea alba
A1XG09 0.00086 42 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Nuphar advena
Q8WHX5 0.001 41 33 2 78 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Psilotum nudum
Q06GU2 0.001 41 31 3 88 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Drimys granadensis
A0A389 0.001 41 32 3 87 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Coffea arabica

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS00820
Feature type CDS
Gene -
Product 4Fe-4S dicluster domain-containing protein
Location 205660 - 206211 (strand: -1)
Length 552 (nucleotides) / 183 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_21
Orthogroup size 19
N. genomes 7

Actions

Genomic region

Domains

PF13247 4Fe-4S dicluster domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0437 Energy production and conversion (C) C Fe-S-cluster-containing dehydrogenase component (DMSO reductase)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07307 anaerobic dimethyl sulfoxide reductase subunit B Sulfur metabolism
Metabolic pathways		 -

Protein Sequence

MAKKQYGFLINSKDCYGCRTCSMACKSENVTPPGVLWRRVREFNEDLPNAQAFITMSCNHCDDPQCLKVCPADTYTKRADGIVIQDHDKCIGCQMCIMACPYNAPVYDPVEGKTSKCNMCADRIDEGLKPRCVESCPTGAIEFGEIEDLRQKHITNWALLEKRYGVPDHTISHPNIVIIGMED

Flanking regions ( +/- flanking 50bp)

GGTCATTGTTGTAACAGTACCCTAATTAATGTGAGACGGGAGGCATAATCATGGCTAAAAAACAGTATGGTTTTCTGATTAATAGTAAAGATTGTTATGGCTGTCGCACTTGTTCGATGGCTTGTAAATCAGAAAATGTTACCCCTCCAGGAGTCTTGTGGCGTAGAGTACGCGAATTCAATGAAGATCTGCCCAATGCGCAAGCTTTTATCACTATGTCCTGTAATCATTGTGACGATCCACAATGCTTAAAAGTCTGCCCTGCCGATACTTATACTAAGCGAGCTGATGGGATTGTGATACAGGATCATGACAAATGTATTGGTTGCCAAATGTGCATTATGGCATGCCCTTATAATGCGCCGGTTTACGATCCTGTAGAAGGGAAGACCAGTAAATGTAATATGTGTGCCGATAGAATAGACGAAGGCTTAAAACCTCGCTGTGTTGAATCTTGTCCAACTGGTGCCATTGAGTTTGGCGAAATTGAAGATTTGCGCCAAAAACATATCACAAATTGGGCATTATTAGAAAAACGTTATGGGGTTCCTGATCATACCATCAGTCATCCTAATATTGTCATTATTGGTATGGAGGATTAACCATGCATGATTATCAAATGCCTTTGGTTCTATTCACCGTAATGAGTCAA