Homologs in group_404

Help

7 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_16315 FBDBKF_16315 100.0 Morganella morganii S1 rfaD ADP-glyceromanno-heptose 6-epimerase
EHELCC_16350 EHELCC_16350 100.0 Morganella morganii S2 rfaD ADP-glyceromanno-heptose 6-epimerase
NLDBIP_16990 NLDBIP_16990 100.0 Morganella morganii S4 rfaD ADP-glyceromanno-heptose 6-epimerase
LHKJJB_16910 LHKJJB_16910 100.0 Morganella morganii S3 rfaD ADP-glyceromanno-heptose 6-epimerase
F4V73_RS17275 F4V73_RS17275 92.9 Morganella psychrotolerans rfaD ADP-glyceromanno-heptose 6-epimerase
PMI_RS05600 PMI_RS05600 24.7 Proteus mirabilis HI4320 - SDR family oxidoreductase
PMI_RS15705 PMI_RS15705 84.3 Proteus mirabilis HI4320 rfaD ADP-glyceromanno-heptose 6-epimerase

Distribution of the homologs in the orthogroup group_404

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_404

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
C6DIA9 0.0 562 87 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6DAT7 0.0 561 87 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A1JHX6 0.0 558 86 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B4F132 0.0 558 84 0 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Proteus mirabilis (strain HI4320)
B1JQW4 0.0 554 85 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66GC7 0.0 554 85 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TSC8 0.0 554 85 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Yersinia pestis (strain Pestoides F)
Q1CD11 0.0 554 85 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R683 0.0 554 85 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZJN4 0.0 554 85 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Yersinia pestis
B2JYP2 0.0 554 85 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C276 0.0 554 85 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FCU3 0.0 554 85 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A7MQ91 0.0 549 84 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Cronobacter sakazakii (strain ATCC BAA-894)
Q2NQV7 0.0 547 84 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Sodalis glossinidius (strain morsitans)
A8ARK8 0.0 547 84 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q7MY46 0.0 546 83 0 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q329N6 0.0 544 83 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Shigella dysenteriae serotype 1 (strain Sd197)
B7LVH8 0.0 542 83 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B6I3J9 0.0 542 83 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli (strain SE11)
P67910 0.0 542 83 1 310 1 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli (strain K12)
B1X953 0.0 542 83 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli (strain K12 / DH10B)
C4ZXL1 0.0 542 83 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli (strain K12 / MC4100 / BW2952)
B7M4A5 0.0 542 83 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli O8 (strain IAI1)
B5YWC0 0.0 542 83 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli O157:H7 (strain EC4115 / EHEC)
P67911 0.0 542 83 1 310 1 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli O157:H7
B7L745 0.0 542 83 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli (strain 55989 / EAEC)
B7ULH4 0.0 542 83 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZTH2 0.0 542 83 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q3YVY3 0.0 541 83 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Shigella sonnei (strain Ss046)
Q83PP2 0.0 541 83 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Shigella flexneri
Q0SYE8 0.0 541 83 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Shigella flexneri serotype 5b (strain 8401)
Q31V04 0.0 541 83 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Shigella boydii serotype 4 (strain Sb227)
B2U5D7 0.0 541 83 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1R4X2 0.0 541 83 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli (strain UTI89 / UPEC)
B7NES6 0.0 541 83 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q8FCA0 0.0 541 83 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TBI8 0.0 541 83 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AHF5 0.0 541 83 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli O1:K1 / APEC
B7N1S3 0.0 541 83 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli O81 (strain ED1a)
B7NPC7 0.0 541 83 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7MFI2 0.0 541 83 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli O45:K1 (strain S88 / ExPEC)
C5BB97 0.0 540 84 2 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Edwardsiella ictaluri (strain 93-146)
B5XTI2 0.0 540 82 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Klebsiella pneumoniae (strain 342)
B1LK58 0.0 539 82 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli (strain SMS-3-5 / SECEC)
A6TFL4 0.0 538 82 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B1IZH2 0.0 538 82 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A683 0.0 538 82 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli O9:H4 (strain HS)
A9MKQ6 0.0 538 82 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5RGG8 0.0 538 82 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R5E3 0.0 538 82 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella enteritidis PT4 (strain P125109)
B5FLI8 0.0 538 82 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella dublin (strain CT_02021853)
B4SXC1 0.0 537 82 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella newport (strain SL254)
A8GLC8 0.0 536 83 2 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Serratia proteamaculans (strain 568)
P67912 0.0 536 82 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P67913 0.0 536 82 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella typhi
B4TZW1 0.0 536 82 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella schwarzengrund (strain CVM19633)
B5BHZ3 0.0 536 82 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella paratyphi A (strain AKU_12601)
A9MVL2 0.0 536 82 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PC05 0.0 536 82 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T9A3 0.0 536 82 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella heidelberg (strain SL476)
B5EXC5 0.0 536 82 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella agona (strain SL483)
Q9XCA1 0.0 536 81 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Klebsiella pneumoniae
C0Q1V2 0.0 535 82 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella paratyphi C (strain RKS4594)
Q57IC3 0.0 535 82 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella choleraesuis (strain SC-B67)
A4W527 0.0 533 81 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Enterobacter sp. (strain 638)
B2VL47 0.0 521 79 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
B8F727 0.0 510 78 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Glaesserella parasuis serovar 5 (strain SH0165)
B3GYT6 0.0 506 76 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
B0BSD7 0.0 505 76 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A3N308 0.0 505 76 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
A6VLD2 1.15e-180 503 78 2 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
P45048 3.82e-178 497 78 2 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4QLI0 5.8e-178 496 78 2 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Haemophilus influenzae (strain 86-028NP)
A5UIN9 6.47e-178 496 78 2 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Haemophilus influenzae (strain PittGG)
B0UWU3 8.72e-178 496 75 2 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Histophilus somni (strain 2336)
Q0I569 8.72e-178 496 75 2 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Histophilus somni (strain 129Pt)
Q65WA7 1.12e-177 496 76 2 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q7VKK8 1.84e-177 495 74 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q9CL97 1.88e-170 478 75 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Pasteurella multocida (strain Pm70)
A4SHC0 2.38e-162 457 68 4 321 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Aeromonas salmonicida (strain A449)
B5FFS9 1.11e-161 456 71 3 316 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Aliivibrio fischeri (strain MJ11)
A0KQV3 1.58e-161 455 68 4 320 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A7MSM1 4.66e-161 454 71 3 316 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Vibrio campbellii (strain ATCC BAA-1116)
Q5E8J9 1.45e-160 452 71 3 316 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q8DE09 3.73e-160 452 72 3 315 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Vibrio vulnificus (strain CMCP6)
C3LQK1 1.93e-159 450 71 3 316 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Vibrio cholerae serotype O1 (strain M66-2)
Q06963 1.93e-159 450 71 3 316 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F3Z4 1.93e-159 450 71 3 316 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q7MPN6 2.42e-159 449 72 3 315 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Vibrio vulnificus (strain YJ016)
Q87T56 6.64e-159 448 71 3 315 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A1SRT6 1.15e-156 443 68 4 316 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
C4K8I6 2.71e-156 442 67 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q31FG4 1.34e-146 418 66 4 315 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q3A8K5 6.13e-146 416 65 5 317 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
A1TYR6 3.36e-137 394 63 4 316 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
B8CVJ3 1.75e-136 392 62 5 314 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Shewanella piezotolerans (strain WP3 / JCM 13877)
Q98I52 8.15e-136 390 61 5 315 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
A3QJB2 8.92e-136 390 62 5 314 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q1R1N5 1.4e-135 390 60 5 320 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q07W60 9.44e-133 382 61 5 314 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Shewanella frigidimarina (strain NCIMB 400)
Q3J7X9 3.31e-126 366 57 5 317 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q5P2S1 2.13e-124 361 57 4 316 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q47GJ3 2.8e-122 356 58 6 329 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Dechloromonas aromatica (strain RCB)
A1KBH4 1.24e-121 354 57 6 321 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Azoarcus sp. (strain BH72)
Q0A4T8 3.85e-119 348 56 5 313 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
C0QZ84 7.72e-119 347 56 4 314 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Brachyspira hyodysenteriae (strain ATCC 49526 / WA1)
Q8Y0X8 1.94e-117 344 55 5 326 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
A9ADU8 4.64e-117 343 55 5 327 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia multivorans (strain ATCC 17616 / 249)
A3NC24 5.52e-117 343 55 5 326 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia pseudomallei (strain 668)
Q3JPY8 5.52e-117 343 55 5 326 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia pseudomallei (strain 1710b)
A3NXW3 5.52e-117 343 55 5 326 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia pseudomallei (strain 1106a)
A1V6L4 5.52e-117 343 55 5 326 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia mallei (strain SAVP1)
Q62M34 5.52e-117 343 55 5 326 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia mallei (strain ATCC 23344)
A2S4R1 5.52e-117 343 55 5 326 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia mallei (strain NCTC 10229)
A3MHP7 5.52e-117 343 55 5 326 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia mallei (strain NCTC 10247)
P0DMK5 5.64e-117 343 55 5 326 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia pseudomallei (strain K96243)
Q2SY18 1.61e-116 342 55 5 326 1 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q1BY20 2.14e-116 341 55 5 327 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia orbicola (strain AU 1054)
B1JXS7 2.14e-116 341 55 5 327 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia orbicola (strain MC0-3)
A0K5M9 2.14e-116 341 55 5 327 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia cenocepacia (strain HI2424)
Q1LQG2 3.1e-116 341 57 7 328 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q39IF3 3.27e-116 341 55 5 327 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
B2T625 4.02e-116 341 54 6 326 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
B4EB34 4.02e-116 341 55 5 327 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
I1WGR6 6.57e-116 340 55 5 326 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia pseudomallei (strain 1026b)
Q13VD0 1.85e-115 339 54 6 326 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Paraburkholderia xenovorans (strain LB400)
A4JCI2 3.03e-115 338 55 5 327 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia vietnamiensis (strain G4 / LMG 22486)
B2JF12 3.53e-115 338 54 6 327 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q0BH85 3.69e-115 338 54 5 327 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YV41 8.36e-115 337 54 5 327 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia ambifaria (strain MC40-6)
B2U894 4.69e-114 335 54 6 326 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Ralstonia pickettii (strain 12J)
Q0KDH0 6.57e-114 335 54 5 326 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
B3R3C0 1.52e-113 334 54 5 330 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
A9IJJ7 1.85e-110 326 53 6 326 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q12CM2 8.24e-110 325 55 6 330 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Polaromonas sp. (strain JS666 / ATCC BAA-500)
A6V291 1.74e-109 324 54 7 329 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Pseudomonas aeruginosa (strain PA7)
Q3SK74 4.04e-109 323 53 5 328 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Thiobacillus denitrificans (strain ATCC 25259)
B1XVP6 6.76e-109 323 52 6 328 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Polynucleobacter necessarius subsp. necessarius (strain STIR1)
Q02QH1 5.41e-108 320 53 7 329 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Pseudomonas aeruginosa (strain UCBPP-PA14)
Q9HYQ8 5.53e-108 320 53 7 329 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q7VZF5 8.74e-108 320 52 6 326 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W609 9.43e-108 319 53 6 326 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WGU9 9.43e-108 319 53 6 326 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
A1VR25 2.31e-107 318 54 6 331 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Polaromonas naphthalenivorans (strain CJ2)
Q7NTL6 4.02e-107 318 52 5 327 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
A9M3Q7 1.46e-104 311 52 7 328 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Neisseria meningitidis serogroup C (strain 053442)
Q9K002 2.63e-104 311 52 7 328 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9JQX8 3.94e-104 310 51 7 328 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q2L2R8 1.01e-103 309 52 6 326 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Bordetella avium (strain 197N)
Q51061 1.29e-103 309 51 7 328 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Neisseria gonorrhoeae
A1KT78 1.68e-103 309 51 7 328 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q5F9J0 9.65e-102 304 51 6 328 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q21Y60 1.83e-99 299 50 7 336 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q46Y59 1.74e-94 286 48 5 326 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q8RIA5 3.19e-75 236 43 7 322 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q72ET7 7.73e-72 228 42 7 317 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
A1VGB0 7.82e-72 228 42 7 317 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Nitratidesulfovibrio vulgaris (strain DP4)
Q57664 5.31e-27 110 31 16 329 3 MJ0211 Putative UDP-glucose 4-epimerase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q59083 1.07e-22 99 28 13 334 3 exoB UDP-glucose 4-epimerase Azospirillum brasilense
Q7WTB1 7.29e-14 74 30 12 279 2 galE UDP-glucose 4-epimerase Lactobacillus helveticus
Q9SA77 1.58e-13 73 25 10 300 1 MUR4 UDP-arabinose 4-epimerase 1 Arabidopsis thaliana
Q04973 3.52e-13 72 25 14 327 3 vipB Vi polysaccharide biosynthesis protein VipB/TviC Salmonella typhi
P21977 4.29e-13 72 25 11 329 3 galE UDP-glucose 4-epimerase Streptococcus thermophilus
O64749 5.64e-13 72 24 8 282 2 At2g34850 Putative UDP-arabinose 4-epimerase 2 Arabidopsis thaliana
P96995 5.68e-13 72 26 12 329 3 galE UDP-glucose 4-epimerase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q45291 1.26e-12 70 22 10 337 3 galE UDP-glucose 4-epimerase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
P33119 1.47e-12 70 28 13 276 3 galE UDP-glucose 4-epimerase Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
O34886 2.2e-12 70 25 14 320 3 ytcB Uncharacterized UDP-glucose epimerase YtcB Bacillus subtilis (strain 168)
Q564Q1 2.25e-12 70 27 11 287 1 gale-1 UDP-glucose 4-epimerase Caenorhabditis elegans
P75517 2.97e-12 69 27 12 295 3 galE UDP-glucose 4-epimerase Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q9SUN3 5.11e-12 69 25 9 281 2 At4g20460 Probable UDP-arabinose 4-epimerase 3 Arabidopsis thaliana
Q9FI17 6.02e-12 69 23 9 300 3 At5g44480 Putative UDP-arabinose 4-epimerase 4 Arabidopsis thaliana
Q9KDV3 1.89e-11 67 26 10 300 3 galE UDP-glucose 4-epimerase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P47364 2.06e-11 67 26 12 293 3 galE UDP-glucose 4-epimerase Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
B0M3E8 2.66e-11 67 25 13 302 1 UGE1 Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 1 Pisum sativum
Q8H0B6 6.91e-11 65 24 7 281 2 UEL-2 Probable UDP-arabinose 4-epimerase 2 Oryza sativa subsp. japonica
D4GU72 9.9e-11 65 27 14 310 3 agl12 Low-salt glycan biosynthesis protein Agl12 Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
Q42605 1.24e-10 65 26 13 291 1 UGE1 Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 1 Arabidopsis thaliana
Q43070 1.48e-10 64 25 13 302 2 GALE UDP-glucose 4-epimerase Pisum sativum
Q59745 1.53e-10 64 23 10 303 3 exoB UDP-glucose 4-epimerase Rhizobium leguminosarum bv. trifolii
P26503 1.86e-10 64 26 8 268 3 exoB UDP-glucose 4-epimerase Rhizobium meliloti (strain 1021)
Q8LDN8 2.79e-10 63 26 15 303 1 UGE3 Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 3 Arabidopsis thaliana
Q7BJX9 6.54e-10 62 24 12 324 1 wbgU UDP-N-acetylglucosamine 4-epimerase Plesiomonas shigelloides
O95455 7.45e-10 62 25 8 283 1 TGDS dTDP-D-glucose 4,6-dehydratase Homo sapiens
Q58455 1.51e-09 61 25 17 337 3 MJ1055 Uncharacterized protein MJ1055 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
A6QLW2 1.82e-09 61 24 8 283 2 TGDS dTDP-D-glucose 4,6-dehydratase Bos taurus
Q8H0B2 1.96e-09 61 25 10 285 2 UEL-3 Probable UDP-arabinose 4-epimerase 3 Oryza sativa subsp. japonica
O65780 2.22e-09 61 26 13 296 2 None UDP-glucose 4-epimerase GEPI42 Cyamopsis tetragonoloba
Q8VDR7 2.53e-09 61 24 9 283 2 Tgds dTDP-D-glucose 4,6-dehydratase Mus musculus
Q8H930 5.66e-09 60 24 8 283 2 UEL-1 Probable UDP-arabinose 4-epimerase 1 Oryza sativa subsp. japonica
Q05026 7.83e-09 59 26 14 287 3 galE UDP-glucose 4-epimerase Neisseria gonorrhoeae
D4GU71 8.9e-09 59 25 8 242 3 agl14 Probable low-salt glycan biosynthesis reductase Agl14 Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
O84903 9.3e-09 59 26 13 329 3 galE UDP-glucose 4-epimerase Lacticaseibacillus casei
Q9SN58 1.11e-08 59 26 12 283 1 UGE5 UDP-glucose 4-epimerase 5 Arabidopsis thaliana
Q8LNZ3 1.36e-08 58 25 12 287 2 UGE-1 UDP-glucose 4-epimerase 1 Oryza sativa subsp. japonica
Q6ZDJ7 1.73e-08 58 27 13 284 2 UGE-2 UDP-glucose 4-epimerase 2 Oryza sativa subsp. japonica
P13226 2.31e-08 58 26 11 283 3 galE UDP-glucose 4-epimerase Streptomyces lividans
Q57301 2.42e-08 58 27 12 274 3 galE UDP-glucose 4-epimerase Yersinia enterocolitica
P56986 2.88e-08 57 25 16 326 3 galE UDP-glucose 4-epimerase Neisseria meningitidis serogroup C
Q652A8 2.91e-08 58 25 13 283 2 UGE-3 UDP-glucose 4-epimerase 3 Oryza sativa subsp. japonica
O65781 3.84e-08 57 25 13 285 2 None UDP-glucose 4-epimerase GEPI48 Cyamopsis tetragonoloba
Q6K2E1 5.95e-08 57 25 11 283 2 UGE-4 UDP-glucose 4-epimerase 4 Oryza sativa subsp. japonica
P22715 6.14e-08 57 24 15 310 3 galE UDP-glucose 4-epimerase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q56093 6.66e-08 56 24 15 310 3 galE UDP-glucose 4-epimerase Salmonella typhi
P39858 9.99e-08 56 25 11 239 3 capI Protein CapI Staphylococcus aureus
P56985 1.24e-07 55 24 14 324 3 galE UDP-glucose 4-epimerase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q04871 1.27e-07 55 26 11 241 3 None Uncharacterized 37.6 kDa protein in cld 5'region Escherichia coli O111:H-
P55180 1.58e-07 55 28 9 187 3 galE UDP-glucose 4-epimerase Bacillus subtilis (strain 168)
Q9CNY5 1.7e-07 55 27 14 292 3 galE UDP-glucose 4-epimerase Pasteurella multocida (strain Pm70)
Q9F7D4 2.18e-07 55 25 12 278 3 galE UDP-glucose 4-epimerase Yersinia pestis
F8C4X8 2.89e-07 54 26 8 254 1 TOPB45_0660 UDP-glucuronate 4-epimerase Thermodesulfobacterium geofontis (strain OPF15)
P09147 2.94e-07 54 23 15 310 1 galE UDP-glucose 4-epimerase Escherichia coli (strain K12)
Q9HDU3 3.94e-07 55 27 15 287 3 gal10 Bifunctional protein gal10 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q9C7W7 3.99e-07 54 24 13 287 1 UGE4 UDP-glucose 4-epimerase 4 Arabidopsis thaliana
P56997 5.05e-07 54 25 16 325 3 galE UDP-glucose 4-epimerase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q6E7F2 1.51e-06 52 22 8 264 1 fcf1 dTDP-4-dehydro-6-deoxyglucose reductase Escherichia coli
P35673 2.2e-06 52 25 14 301 3 galE UDP-glucose 4-epimerase Erwinia amylovora
P04397 2.6e-06 52 25 16 328 1 GAL10 Bifunctional protein GAL10 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q9LPC1 2.75e-06 52 24 10 234 2 GAE2 UDP-glucuronate 4-epimerase 2 Arabidopsis thaliana
P24325 3.2e-06 51 24 11 298 3 galE UDP-glucose 4-epimerase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q553X7 4.35e-06 51 25 14 303 1 galE UDP-glucose 4-epimerase Dictyostelium discoideum
P09609 4.51e-06 51 26 13 291 2 GAL10 Bifunctional protein GAL10 Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
Q9T0A7 4.58e-06 51 24 12 281 1 UGE2 UDP-glucose 4-epimerase 2 Arabidopsis thaliana
P44094 5.07e-06 50 24 6 166 1 denD D-erythronate dehydrogenase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P21097 8.38e-06 50 28 13 237 2 OPG174 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase Vaccinia virus (strain Copenhagen)
O57245 9.01e-06 50 30 11 197 2 OPG174 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase Vaccinia virus (strain Ankara)
Q5PQX0 9.12e-06 50 23 8 282 1 Uxs1 UDP-glucuronic acid decarboxylase 1 Rattus norvegicus
P95780 9.3e-06 50 24 15 337 1 rmlB dTDP-glucose 4,6-dehydratase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
P26670 1.02e-05 50 27 12 237 2 OPG174 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase Vaccinia virus (strain Western Reserve)
Q5R885 1.11e-05 50 23 8 282 2 UXS1 UDP-glucuronic acid decarboxylase 1 Pongo abelii
Q91XL3 1.13e-05 50 23 8 282 1 Uxs1 UDP-glucuronic acid decarboxylase 1 Mus musculus
Q8NBZ7 1.18e-05 50 23 8 282 1 UXS1 UDP-glucuronic acid decarboxylase 1 Homo sapiens
O22141 1.58e-05 49 25 10 240 1 GAE4 UDP-glucuronate 4-epimerase 4 Arabidopsis thaliana
Q6DF08 2.56e-05 49 23 7 258 2 uxs1 UDP-glucuronic acid decarboxylase 1 Xenopus tropicalis
A0A7H0DNE2 3.39e-05 48 28 13 237 2 OPG174 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase Monkeypox virus
Q9M0B6 3.48e-05 48 26 12 244 1 GAE1 UDP-glucuronate 4-epimerase 1 Arabidopsis thaliana
Q0KBD2 4.08e-05 48 29 6 169 1 denD D-erythronate dehydrogenase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
A2Z7B3 5.54e-05 48 22 11 300 2 OsI_032456 GDP-mannose 3,5-epimerase 1 Oryza sativa subsp. indica
Q9SYM5 6.16e-05 48 24 19 336 1 RHM1 Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM1 Arabidopsis thaliana
P40801 6.8e-05 48 25 13 293 2 GAL10 Bifunctional protein GAL10 Pachysolen tannophilus
A0QSK6 7.01e-05 47 26 8 222 1 rmlB dTDP-glucose 4,6-dehydratase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
A3C4S4 7.24e-05 47 23 11 300 1 GME-1 GDP-mannose 3,5-epimerase 1 Oryza sativa subsp. japonica
Q8VZC0 9.45e-05 47 24 10 262 1 UXS1 UDP-glucuronic acid decarboxylase 1 Arabidopsis thaliana
A0A7L8UVC9 0.000134 47 23 2 123 3 ffsA Polyketide synthase-nonribosomal peptide synthetase ffsA Aspergillus flavipes
Q0P8I7 0.000176 46 25 12 228 1 Cj1427c GDP-D-glycero-alpha-D-manno-heptose dehydrogenase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q9LH76 0.000432 45 25 22 337 2 RHM3 Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM3 Arabidopsis thaliana
Q8S8T4 0.000542 45 23 9 247 2 UXS4 UDP-glucuronic acid decarboxylase 4 Arabidopsis thaliana
A0A4P8WAE5 0.000555 45 25 6 199 3 pyiS Polyketide synthase-nonribosomal peptide synthetase pyiS Pyricularia grisea
Q6GMI9 0.000612 44 21 8 273 1 uxs1 UDP-glucuronic acid decarboxylase 1 Danio rerio

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_16930
Feature type CDS
Gene rfaD
Product ADP-glyceromanno-heptose 6-epimerase
Location 50805 - 51743 (strand: -1)
Length 939 (nucleotides) / 312 (amino acids)

Contig

Accession ZDB_698
Length 62170 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_404
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF01370 NAD dependent epimerase/dehydratase family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0451 Cell wall/membrane/envelope biogenesis (M) M Nucleoside-diphosphate-sugar epimerase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03274 ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20] Lipopolysaccharide biosynthesis
Metabolic pathways
Biosynthesis of nucleotide sugars
ADP-L-glycero-D-manno-heptose biosynthesis

Virulence factor Annotation(s)

VF gene ID Protein VF ID Category
VFG000332 ADP-L-glycero-D-mannoheptose-6-epimerase VF0044 Immune modulation

Protein Sequence

MIIVTGGAGFIGSNIVKALNDDGYTDILVVDNLKDGTKFVNLVDLNIADYMDKEDFIAGIVAGDDFGDIEAVFHEGACSSTTEWDGKYMMDNNYQYSKELLHYCLDRQIPFLYASSAATYGGRSDNFIEDRQYEKPLNVYGYSKFLFDQYVREILPEAESQICGFRYFNVYGPREGHKGSMASVAFHLNNQILNGENPKLFSGSENFLRDFIYVGDVADVNLWFWKNAKSGIFNCGTGRAESFQAVADAVTGFHSERQCALDYIPFPEKLKGRYQAYTQADLTNLRAAGYPGEFKTVAEGVREYMAWLNQGN

Flanking regions ( +/- flanking 50bp)

AAGCAGTGATTTTTTCATTTTCTTGAATGAACCGAACAGAGGAATGCGTGATGATTATTGTCACCGGCGGTGCCGGATTTATCGGCAGCAATATTGTAAAAGCACTGAATGATGACGGTTACACTGATATTTTAGTCGTGGATAACCTGAAAGACGGCACCAAATTTGTCAATCTGGTCGATCTGAATATCGCCGATTACATGGATAAAGAAGATTTTATCGCCGGTATTGTAGCCGGGGATGATTTCGGGGATATCGAAGCAGTATTCCATGAAGGTGCCTGCTCATCCACCACCGAGTGGGACGGCAAGTACATGATGGATAATAACTATCAGTACTCCAAAGAACTGCTGCATTATTGTCTGGATCGTCAGATCCCGTTCCTGTATGCCTCTTCTGCCGCCACCTACGGCGGGCGCAGTGATAACTTTATTGAAGATCGGCAGTATGAAAAACCATTAAATGTGTATGGTTATTCCAAATTCCTGTTTGATCAGTATGTCCGTGAAATCCTGCCGGAAGCAGAGTCTCAGATCTGCGGTTTCCGTTATTTCAACGTCTACGGCCCGCGTGAAGGCCATAAAGGCAGCATGGCGAGTGTCGCTTTCCATCTGAATAATCAGATTTTAAACGGCGAAAACCCGAAATTATTCTCCGGCAGTGAAAACTTCCTGCGTGATTTCATCTATGTGGGTGATGTGGCAGATGTAAATCTGTGGTTCTGGAAAAATGCCAAATCCGGTATTTTCAACTGCGGTACCGGCCGTGCGGAATCTTTCCAGGCTGTCGCTGATGCTGTGACCGGTTTCCACAGCGAACGCCAGTGCGCGCTCGATTACATCCCGTTCCCGGAAAAACTGAAAGGCCGCTATCAGGCGTATACCCAGGCTGACCTGACCAATCTGCGTGCAGCCGGTTACCCGGGTGAGTTCAAAACGGTCGCCGAAGGTGTCCGTGAATATATGGCTTGGTTAAATCAGGGGAATTAATTAAACGCACATGAAAATTCTGGTGATCGGGCCGTCGTGGGTCGGTGACA