Homologs in group_404

Help

7 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_16315 FBDBKF_16315 84.3 Morganella morganii S1 rfaD ADP-glyceromanno-heptose 6-epimerase
EHELCC_16350 EHELCC_16350 84.3 Morganella morganii S2 rfaD ADP-glyceromanno-heptose 6-epimerase
NLDBIP_16990 NLDBIP_16990 84.3 Morganella morganii S4 rfaD ADP-glyceromanno-heptose 6-epimerase
LHKJJB_16910 LHKJJB_16910 84.3 Morganella morganii S3 rfaD ADP-glyceromanno-heptose 6-epimerase
HKOGLL_16930 HKOGLL_16930 84.3 Morganella morganii S5 rfaD ADP-glyceromanno-heptose 6-epimerase
F4V73_RS17275 F4V73_RS17275 82.1 Morganella psychrotolerans rfaD ADP-glyceromanno-heptose 6-epimerase
PMI_RS05600 PMI_RS05600 24.7 Proteus mirabilis HI4320 - SDR family oxidoreductase

Distribution of the homologs in the orthogroup group_404

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_404

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4F132 0.0 650 100 0 312 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Proteus mirabilis (strain HI4320)
Q7MY46 0.0 572 85 0 312 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
C6DIA9 0.0 561 85 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A7MQ91 0.0 557 84 1 311 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Cronobacter sakazakii (strain ATCC BAA-894)
Q6DAT7 0.0 557 84 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q2NQV7 0.0 551 82 1 311 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Sodalis glossinidius (strain morsitans)
A8ARK8 0.0 551 84 1 311 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A6TFL4 0.0 549 83 1 311 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A1JHX6 0.0 548 83 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B5XTI2 0.0 547 83 1 311 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Klebsiella pneumoniae (strain 342)
Q9XCA1 0.0 546 83 1 311 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Klebsiella pneumoniae
B1JQW4 0.0 545 83 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66GC7 0.0 545 83 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TSC8 0.0 545 83 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Yersinia pestis (strain Pestoides F)
Q1CD11 0.0 545 83 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R683 0.0 545 83 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZJN4 0.0 545 83 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Yersinia pestis
B2JYP2 0.0 545 83 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C276 0.0 545 83 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FCU3 0.0 545 83 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q329N6 0.0 545 83 1 311 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Shigella dysenteriae serotype 1 (strain Sd197)
B7LVH8 0.0 544 82 1 311 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B6I3J9 0.0 544 82 1 311 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli (strain SE11)
P67910 0.0 544 82 1 311 1 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli (strain K12)
B1X953 0.0 544 82 1 311 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli (strain K12 / DH10B)
C4ZXL1 0.0 544 82 1 311 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli (strain K12 / MC4100 / BW2952)
B7M4A5 0.0 544 82 1 311 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli O8 (strain IAI1)
B5YWC0 0.0 544 82 1 311 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli O157:H7 (strain EC4115 / EHEC)
P67911 0.0 544 82 1 311 1 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli O157:H7
B7L745 0.0 544 82 1 311 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli (strain 55989 / EAEC)
B7ULH4 0.0 544 82 1 311 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZTH2 0.0 544 82 1 311 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli O139:H28 (strain E24377A / ETEC)
B5RGG8 0.0 543 82 1 311 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R5E3 0.0 543 82 1 311 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella enteritidis PT4 (strain P125109)
B5FLI8 0.0 543 82 1 311 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella dublin (strain CT_02021853)
B4SXC1 0.0 543 82 1 311 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella newport (strain SL254)
P67912 0.0 542 82 1 311 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P67913 0.0 542 82 1 311 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella typhi
B4TZW1 0.0 542 82 1 311 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella schwarzengrund (strain CVM19633)
B5BHZ3 0.0 542 82 1 311 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella paratyphi A (strain AKU_12601)
A9MVL2 0.0 542 82 1 311 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PC05 0.0 542 82 1 311 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T9A3 0.0 542 82 1 311 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella heidelberg (strain SL476)
B5EXC5 0.0 542 82 1 311 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella agona (strain SL483)
Q3YVY3 0.0 542 82 1 311 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Shigella sonnei (strain Ss046)
Q83PP2 0.0 542 82 1 311 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Shigella flexneri
Q0SYE8 0.0 542 82 1 311 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Shigella flexneri serotype 5b (strain 8401)
Q31V04 0.0 542 82 1 311 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Shigella boydii serotype 4 (strain Sb227)
B2U5D7 0.0 542 82 1 311 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1R4X2 0.0 542 82 1 311 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli (strain UTI89 / UPEC)
B7NES6 0.0 542 82 1 311 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q8FCA0 0.0 542 82 1 311 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TBI8 0.0 542 82 1 311 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AHF5 0.0 542 82 1 311 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli O1:K1 / APEC
B7N1S3 0.0 542 82 1 311 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli O81 (strain ED1a)
B7NPC7 0.0 542 82 1 311 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7MFI2 0.0 542 82 1 311 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli O45:K1 (strain S88 / ExPEC)
B1IZH2 0.0 541 82 1 311 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A683 0.0 541 82 1 311 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli O9:H4 (strain HS)
A4W527 0.0 541 81 1 311 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Enterobacter sp. (strain 638)
C0Q1V2 0.0 540 82 1 311 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella paratyphi C (strain RKS4594)
Q57IC3 0.0 540 82 1 311 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella choleraesuis (strain SC-B67)
B1LK58 0.0 540 82 1 311 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli (strain SMS-3-5 / SECEC)
A9MKQ6 0.0 539 82 1 311 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
C5BB97 0.0 539 83 2 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Edwardsiella ictaluri (strain 93-146)
A8GLC8 0.0 537 81 2 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Serratia proteamaculans (strain 568)
B2VL47 0.0 523 79 1 311 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
B8F727 0.0 515 78 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Glaesserella parasuis serovar 5 (strain SH0165)
B3GYT6 1.2e-179 501 77 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A5UIN9 1.58e-179 500 78 2 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Haemophilus influenzae (strain PittGG)
B0BSD7 2.16e-179 500 77 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A3N308 2.16e-179 500 77 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
P45048 8.9e-179 499 77 2 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4QLI0 8.9e-179 499 77 2 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Haemophilus influenzae (strain 86-028NP)
B0UWU3 7.9e-178 496 76 2 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Histophilus somni (strain 2336)
Q0I569 7.9e-178 496 76 2 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Histophilus somni (strain 129Pt)
A6VLD2 6.05e-177 494 75 2 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q7VKK8 3.63e-176 492 74 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q65WA7 7.16e-173 484 75 2 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q9CL97 1.03e-170 478 75 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Pasteurella multocida (strain Pm70)
B5FFS9 1.38e-164 463 72 3 316 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Aliivibrio fischeri (strain MJ11)
Q5E8J9 8.86e-164 461 71 3 316 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Aliivibrio fischeri (strain ATCC 700601 / ES114)
C4K8I6 5.94e-162 456 68 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
A7MSM1 9.91e-161 453 69 3 316 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Vibrio campbellii (strain ATCC BAA-1116)
C3LQK1 3.7e-160 452 71 3 316 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Vibrio cholerae serotype O1 (strain M66-2)
Q06963 3.7e-160 452 71 3 316 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F3Z4 3.7e-160 452 71 3 316 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q87T56 8.95e-160 451 70 3 315 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A1SRT6 3.74e-159 449 69 4 316 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
A0KQV3 3.33e-158 447 67 4 320 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A4SHC0 4.19e-157 444 67 4 320 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Aeromonas salmonicida (strain A449)
Q8DE09 7.69e-157 443 70 3 315 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Vibrio vulnificus (strain CMCP6)
Q7MPN6 7.83e-156 441 70 3 315 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Vibrio vulnificus (strain YJ016)
Q3A8K5 1.45e-142 407 64 5 318 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q31FG4 2.84e-142 407 64 5 318 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
A1TYR6 2.45e-137 394 64 4 316 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
B8CVJ3 4.72e-134 385 60 5 314 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Shewanella piezotolerans (strain WP3 / JCM 13877)
A3QJB2 3.2e-133 384 60 5 314 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q1R1N5 7.22e-132 380 58 5 320 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q3J7X9 3.29e-131 379 59 7 321 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q07W60 1.34e-129 374 59 5 314 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Shewanella frigidimarina (strain NCIMB 400)
Q98I52 3.03e-129 374 59 5 318 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q5P2S1 7.64e-125 362 57 5 317 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
A1KBH4 2.92e-124 361 57 7 327 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Azoarcus sp. (strain BH72)
Q47GJ3 5.64e-122 355 57 6 330 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Dechloromonas aromatica (strain RCB)
Q0A4T8 1.21e-116 342 55 4 311 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
A9ADU8 1.68e-116 342 55 7 329 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia multivorans (strain ATCC 17616 / 249)
Q13VD0 2.28e-116 341 54 7 328 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Paraburkholderia xenovorans (strain LB400)
Q0BH85 2.6e-116 341 55 7 329 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q1BY20 3.69e-116 341 55 7 329 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia orbicola (strain AU 1054)
B1JXS7 3.69e-116 341 55 7 329 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia orbicola (strain MC0-3)
B4EB34 3.69e-116 341 55 7 329 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0K5M9 3.69e-116 341 55 7 329 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia cenocepacia (strain HI2424)
Q39IF3 4.69e-116 340 55 7 329 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
A4JCI2 5.4e-116 340 55 7 329 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia vietnamiensis (strain G4 / LMG 22486)
B1YV41 7.25e-116 340 55 7 329 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia ambifaria (strain MC40-6)
B2T625 1.87e-115 339 53 7 328 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q8Y0X8 2.84e-115 338 54 7 328 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
B2JF12 3.61e-115 338 54 7 329 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
C0QZ84 3.89e-115 338 54 5 317 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Brachyspira hyodysenteriae (strain ATCC 49526 / WA1)
Q2SY18 7.57e-115 337 54 7 328 1 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
P0DMK5 8.18e-115 337 54 7 328 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia pseudomallei (strain K96243)
A3NC24 8.36e-115 337 54 7 328 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia pseudomallei (strain 668)
Q3JPY8 8.36e-115 337 54 7 328 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia pseudomallei (strain 1710b)
A3NXW3 8.36e-115 337 54 7 328 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia pseudomallei (strain 1106a)
A1V6L4 8.36e-115 337 54 7 328 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia mallei (strain SAVP1)
Q62M34 8.36e-115 337 54 7 328 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia mallei (strain ATCC 23344)
A2S4R1 8.36e-115 337 54 7 328 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia mallei (strain NCTC 10229)
A3MHP7 8.36e-115 337 54 7 328 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia mallei (strain NCTC 10247)
I1WGR6 1.01e-113 335 54 7 328 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia pseudomallei (strain 1026b)
Q1LQG2 5.7e-113 333 55 6 326 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
B2U894 2.23e-112 331 53 7 328 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Ralstonia pickettii (strain 12J)
Q0KDH0 6.35e-112 330 53 7 328 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
B3R3C0 8.15e-111 327 53 6 326 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q7NTL6 9.65e-108 320 53 6 327 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q3SK74 2.93e-107 318 51 6 328 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Thiobacillus denitrificans (strain ATCC 25259)
A6V291 3.45e-107 318 54 7 327 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Pseudomonas aeruginosa (strain PA7)
B1XVP6 3.65e-107 318 51 6 328 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Polynucleobacter necessarius subsp. necessarius (strain STIR1)
Q9HYQ8 5.89e-107 317 53 7 327 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02QH1 6.42e-107 317 53 7 327 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Pseudomonas aeruginosa (strain UCBPP-PA14)
Q12CM2 3.71e-105 313 53 7 334 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Polaromonas sp. (strain JS666 / ATCC BAA-500)
A9IJJ7 6.74e-105 312 51 6 331 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
A9M3Q7 6.2e-103 307 51 8 330 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Neisseria meningitidis serogroup C (strain 053442)
A1VR25 1.69e-102 306 52 7 334 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Polaromonas naphthalenivorans (strain CJ2)
Q9JQX8 1.73e-102 306 51 7 328 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q9K002 1.86e-102 306 51 7 328 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q7VZF5 7.76e-102 304 50 6 326 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q51061 1.1e-101 304 51 8 330 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Neisseria gonorrhoeae
Q7W609 1.14e-101 304 50 6 326 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WGU9 1.14e-101 304 50 6 326 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
A1KT78 1.46e-101 304 51 8 330 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q5F9J0 5.51e-99 297 51 8 330 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q46Y59 2.12e-97 293 49 6 326 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q2L2R8 5.22e-97 292 48 6 331 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Bordetella avium (strain 197N)
Q21Y60 5.16e-96 290 48 7 338 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q8RIA5 2.09e-76 239 43 8 323 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
A1VGB0 1.36e-69 222 40 5 316 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Nitratidesulfovibrio vulgaris (strain DP4)
Q72ET7 1.46e-69 222 40 5 316 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q57664 1.21e-24 104 32 14 268 3 MJ0211 Putative UDP-glucose 4-epimerase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q59083 8e-19 89 31 12 270 3 exoB UDP-glucose 4-epimerase Azospirillum brasilense
O34886 3.59e-14 75 23 11 318 3 ytcB Uncharacterized UDP-glucose epimerase YtcB Bacillus subtilis (strain 168)
P33119 2.54e-13 72 30 12 269 3 galE UDP-glucose 4-epimerase Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q7WTB1 2.77e-12 69 30 11 261 2 galE UDP-glucose 4-epimerase Lactobacillus helveticus
Q9SA77 1.22e-11 68 24 13 340 1 MUR4 UDP-arabinose 4-epimerase 1 Arabidopsis thaliana
Q45291 1.44e-11 67 25 7 272 3 galE UDP-glucose 4-epimerase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q564Q1 1.91e-11 67 28 14 289 1 gale-1 UDP-glucose 4-epimerase Caenorhabditis elegans
Q9SUN3 2.66e-11 67 25 12 341 2 At4g20460 Probable UDP-arabinose 4-epimerase 3 Arabidopsis thaliana
Q8LDN8 3.11e-11 67 28 14 280 1 UGE3 Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 3 Arabidopsis thaliana
D4GU71 3.67e-11 66 27 10 243 3 agl14 Probable low-salt glycan biosynthesis reductase Agl14 Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
P47364 4e-11 66 28 12 276 3 galE UDP-glucose 4-epimerase Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P96995 4.11e-11 66 28 9 256 3 galE UDP-glucose 4-epimerase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q9KDV3 5.27e-11 66 29 11 267 3 galE UDP-glucose 4-epimerase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P21977 5.82e-11 65 28 9 257 3 galE UDP-glucose 4-epimerase Streptococcus thermophilus
B0M3E8 1.12e-10 65 27 13 279 1 UGE1 Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 1 Pisum sativum
D4GU72 1.37e-10 64 27 12 304 3 agl12 Low-salt glycan biosynthesis protein Agl12 Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
Q04973 2.31e-10 64 24 13 333 3 vipB Vi polysaccharide biosynthesis protein VipB/TviC Salmonella typhi
Q7BJX9 4.01e-10 63 25 11 328 1 wbgU UDP-N-acetylglucosamine 4-epimerase Plesiomonas shigelloides
O64749 4.84e-10 63 24 10 299 2 At2g34850 Putative UDP-arabinose 4-epimerase 2 Arabidopsis thaliana
Q9FI17 5.12e-10 63 24 11 343 3 At5g44480 Putative UDP-arabinose 4-epimerase 4 Arabidopsis thaliana
Q43070 6.03e-10 63 26 13 279 2 GALE UDP-glucose 4-epimerase Pisum sativum
P13226 2.36e-09 61 30 12 269 3 galE UDP-glucose 4-epimerase Streptomyces lividans
A2Z7B3 3.75e-09 60 22 12 330 2 OsI_032456 GDP-mannose 3,5-epimerase 1 Oryza sativa subsp. indica
Q652A8 4.73e-09 60 28 17 286 2 UGE-3 UDP-glucose 4-epimerase 3 Oryza sativa subsp. japonica
A3C4S4 4.8e-09 60 23 12 329 1 GME-1 GDP-mannose 3,5-epimerase 1 Oryza sativa subsp. japonica
Q6ZDJ7 4.9e-09 60 28 15 287 2 UGE-2 UDP-glucose 4-epimerase 2 Oryza sativa subsp. japonica
Q2R1V8 5.7e-09 60 23 12 329 2 GME-2 GDP-mannose 3,5-epimerase 2 Oryza sativa subsp. japonica
Q6K2E1 7.25e-09 59 27 13 286 2 UGE-4 UDP-glucose 4-epimerase 4 Oryza sativa subsp. japonica
P26503 7.5e-09 59 26 11 271 3 exoB UDP-glucose 4-epimerase Rhizobium meliloti (strain 1021)
P75517 8.12e-09 59 28 10 254 3 galE UDP-glucose 4-epimerase Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q59745 8.42e-09 59 24 10 307 3 exoB UDP-glucose 4-epimerase Rhizobium leguminosarum bv. trifolii
Q8LNZ3 1.09e-08 59 26 14 280 2 UGE-1 UDP-glucose 4-epimerase 1 Oryza sativa subsp. japonica
Q42605 1.26e-08 58 26 13 279 1 UGE1 Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 1 Arabidopsis thaliana
O65780 1.57e-08 58 28 14 276 2 None UDP-glucose 4-epimerase GEPI42 Cyamopsis tetragonoloba
Q8H0B2 1.77e-08 58 25 16 345 2 UEL-3 Probable UDP-arabinose 4-epimerase 3 Oryza sativa subsp. japonica
P56986 4.16e-08 57 27 18 326 3 galE UDP-glucose 4-epimerase Neisseria meningitidis serogroup C
Q8H0B6 4.21e-08 57 25 9 284 2 UEL-2 Probable UDP-arabinose 4-epimerase 2 Oryza sativa subsp. japonica
Q8VDR7 5.12e-08 57 26 9 265 2 Tgds dTDP-D-glucose 4,6-dehydratase Mus musculus
Q59678 5.16e-08 57 27 18 296 3 galE UDP-glucose 4-epimerase Mannheimia haemolytica
Q9SN58 9.31e-08 56 28 14 292 1 UGE5 UDP-glucose 4-epimerase 5 Arabidopsis thaliana
P56997 9.37e-08 56 27 20 331 3 galE UDP-glucose 4-epimerase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q58455 1.06e-07 56 24 17 342 3 MJ1055 Uncharacterized protein MJ1055 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q9CNY5 1.09e-07 56 28 17 304 3 galE UDP-glucose 4-epimerase Pasteurella multocida (strain Pm70)
P56985 1.13e-07 56 27 19 331 3 galE UDP-glucose 4-epimerase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9HDU3 1.15e-07 56 28 13 284 3 gal10 Bifunctional protein gal10 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q553X7 1.62e-07 55 25 13 322 1 galE UDP-glucose 4-epimerase Dictyostelium discoideum
O95455 1.72e-07 55 26 8 265 1 TGDS dTDP-D-glucose 4,6-dehydratase Homo sapiens
O65781 2.03e-07 55 27 14 285 2 None UDP-glucose 4-epimerase GEPI48 Cyamopsis tetragonoloba
A6QLW2 2.34e-07 55 26 8 265 2 TGDS dTDP-D-glucose 4,6-dehydratase Bos taurus
Q8H930 3.24e-07 55 27 13 286 2 UEL-1 Probable UDP-arabinose 4-epimerase 1 Oryza sativa subsp. japonica
O84903 3.74e-07 54 32 7 177 3 galE UDP-glucose 4-epimerase Lacticaseibacillus casei
P44094 5.36e-07 53 24 6 166 1 denD D-erythronate dehydrogenase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
F8C4X8 5.68e-07 53 25 15 342 1 TOPB45_0660 UDP-glucuronate 4-epimerase Thermodesulfobacterium geofontis (strain OPF15)
P55180 7.06e-07 53 28 9 187 3 galE UDP-glucose 4-epimerase Bacillus subtilis (strain 168)
Q9LPC1 9.59e-07 53 25 10 234 2 GAE2 UDP-glucuronate 4-epimerase 2 Arabidopsis thaliana
Q8VZC0 9.69e-07 53 25 11 265 1 UXS1 UDP-glucuronic acid decarboxylase 1 Arabidopsis thaliana
Q6E7F2 1.2e-06 52 23 7 261 1 fcf1 dTDP-4-dehydro-6-deoxyglucose reductase Escherichia coli
O22141 1.23e-06 53 25 9 244 1 GAE4 UDP-glucuronate 4-epimerase 4 Arabidopsis thaliana
O81312 1.91e-06 52 25 10 244 2 GAE3 UDP-glucuronate 4-epimerase 3 Arabidopsis thaliana
Q93VR3 2.23e-06 52 23 12 330 1 At5g28840 GDP-mannose 3,5-epimerase Arabidopsis thaliana
P09609 3.51e-06 52 27 14 283 2 GAL10 Bifunctional protein GAL10 Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
Q9C7W7 4.16e-06 51 26 16 289 1 UGE4 UDP-glucose 4-epimerase 4 Arabidopsis thaliana
Q6DF08 4.49e-06 51 25 10 264 2 uxs1 UDP-glucuronic acid decarboxylase 1 Xenopus tropicalis
P35673 4.84e-06 51 26 18 304 3 galE UDP-glucose 4-epimerase Erwinia amylovora
Q5PQX0 5.93e-06 51 25 10 264 1 Uxs1 UDP-glucuronic acid decarboxylase 1 Rattus norvegicus
Q5R885 6.03e-06 51 25 10 264 2 UXS1 UDP-glucuronic acid decarboxylase 1 Pongo abelii
Q8NBZ7 6.6e-06 50 25 10 264 1 UXS1 UDP-glucuronic acid decarboxylase 1 Homo sapiens
Q91XL3 6.72e-06 50 25 10 264 1 Uxs1 UDP-glucuronic acid decarboxylase 1 Mus musculus
Q05026 6.78e-06 50 25 15 298 3 galE UDP-glucose 4-epimerase Neisseria gonorrhoeae
P40801 9.96e-06 50 27 12 291 2 GAL10 Bifunctional protein GAL10 Pachysolen tannophilus
Q9T0A7 1.18e-05 50 27 14 274 1 UGE2 UDP-glucose 4-epimerase 2 Arabidopsis thaliana
Q04871 1.22e-05 49 25 11 240 3 None Uncharacterized 37.6 kDa protein in cld 5'region Escherichia coli O111:H-
Q0P8I7 1.59e-05 49 26 12 232 1 Cj1427c GDP-D-glycero-alpha-D-manno-heptose dehydrogenase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
P39858 1.6e-05 49 26 12 237 3 capI Protein CapI Staphylococcus aureus
P24325 1.75e-05 49 26 14 288 3 galE UDP-glucose 4-epimerase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9F7D4 1.97e-05 49 24 13 295 3 galE UDP-glucose 4-epimerase Yersinia pestis
Q9LH76 2.08e-05 49 26 20 340 2 RHM3 Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM3 Arabidopsis thaliana
Q54WS6 2.51e-05 49 25 11 275 3 tgds dTDP-D-glucose 4,6-dehydratase Dictyostelium discoideum
Q0KBD2 3.25e-05 48 28 6 169 1 denD D-erythronate dehydrogenase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
P09147 3.38e-05 48 26 9 191 1 galE UDP-glucose 4-epimerase Escherichia coli (strain K12)
Q9SYM5 3.52e-05 48 26 21 344 1 RHM1 Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM1 Arabidopsis thaliana
Q9W0P5 3.95e-05 48 27 13 250 1 Gale UDP-glucose 4-epimerase Drosophila melanogaster
P21097 4.24e-05 48 29 12 197 2 OPG174 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase Vaccinia virus (strain Copenhagen)
O57245 4.32e-05 48 29 12 197 2 OPG174 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase Vaccinia virus (strain Ankara)
P26670 4.64e-05 48 29 12 197 2 OPG174 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase Vaccinia virus (strain Western Reserve)
A0A7H0DNE2 4.73e-05 48 28 11 197 2 OPG174 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase Monkeypox virus
Q6GMI9 5.5e-05 48 23 15 332 1 uxs1 UDP-glucuronic acid decarboxylase 1 Danio rerio
Q9ZV36 8.42e-05 47 25 12 268 2 UXS6 UDP-glucuronic acid decarboxylase 6 Arabidopsis thaliana
Q56093 9.19e-05 47 27 9 192 3 galE UDP-glucose 4-epimerase Salmonella typhi
P95780 0.000108 47 24 15 339 1 rmlB dTDP-glucose 4,6-dehydratase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
P04397 0.000156 47 24 12 311 1 GAL10 Bifunctional protein GAL10 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P22715 0.000187 46 26 9 192 3 galE UDP-glucose 4-epimerase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8S8T4 0.000248 46 25 8 187 2 UXS4 UDP-glucuronic acid decarboxylase 4 Arabidopsis thaliana
Q9M0B6 0.000266 45 25 12 244 1 GAE1 UDP-glucuronate 4-epimerase 1 Arabidopsis thaliana
P0DX24 0.000292 45 24 7 181 1 MN2019_09805 3-beta-hydroxysteroid dehydrogenase Mycolicibacterium neoaurum
Q9LPG6 0.000512 45 26 18 293 1 RHM2 Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM2 Arabidopsis thaliana
Q9LZI2 0.000563 45 26 9 188 1 UXS2 UDP-glucuronic acid decarboxylase 2 Arabidopsis thaliana
A0QSK6 0.000646 44 25 6 222 1 rmlB dTDP-glucose 4,6-dehydratase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q6T1X6 0.000705 44 24 8 266 1 rmd GDP-6-deoxy-D-mannose reductase Aneurinibacillus thermoaerophilus
A0A4P8WAE5 0.000817 45 24 10 259 3 pyiS Polyketide synthase-nonribosomal peptide synthetase pyiS Pyricularia grisea

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS15705
Feature type CDS
Gene rfaD
Product ADP-glyceromanno-heptose 6-epimerase
Location 3488695 - 3489633 (strand: -1)
Length 939 (nucleotides) / 312 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_404
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF01370 NAD dependent epimerase/dehydratase family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0451 Cell wall/membrane/envelope biogenesis (M) M Nucleoside-diphosphate-sugar epimerase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03274 ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20] Lipopolysaccharide biosynthesis
Metabolic pathways
Biosynthesis of nucleotide sugars		 ADP-L-glycero-D-manno-heptose biosynthesis

Virulence factor Annotation(s)

VF gene ID Protein VF ID Category
VFG013409 ADP-L-glycero-D-mannoheptose-6-epimerase VF0044 Immune modulation

Protein Sequence

MIIVTGGAGFIGSNIVKALNDEGYTDILVVDNLKDGTKFVNLVDLNIADYMDKEDFIASIVAGDDFGDIDAVFHEGACSSTTEWDGKYMMDNNYQYSKELLHYCLDRQIPFLYASSAATYGGRTDHFIEERKYEAPLNVYGYSKFLFDEYVRQILPEAQSMVCGFRYFNVYGPREGHKGSMASVAFHLNTQVNDGQNPKLFEGSETFQRDFIYVGDVAAVNLWFWRNNVSGIYNCGTGRAESFQAVADAVIAYHNDKDLSVEHIEFPEKLKGRYQAFTQADLTNLRKAGYSAPFKTVAEGVALYMQWLNQDK

Flanking regions ( +/- flanking 50bp)

TATTATAGTTGCAGAGCTAATTTTTAGATTTTATATAAAGGGGTAGCCATATGATTATCGTCACTGGCGGTGCAGGTTTTATCGGCAGCAATATTGTTAAAGCATTAAATGATGAAGGTTATACCGATATTTTAGTGGTTGATAACCTAAAAGATGGCACAAAATTTGTGAATCTTGTCGATCTTAATATCGCTGACTATATGGATAAAGAAGACTTTATTGCCAGTATTGTAGCCGGTGATGATTTTGGTGATATTGATGCCGTATTCCATGAAGGAGCATGCTCTTCTACTACCGAATGGGATGGCAAATATATGATGGATAATAACTATCAATATTCTAAAGAGTTACTGCATTATTGCCTCGATCGCCAAATTCCTTTCTTATATGCCTCTTCTGCTGCCACTTATGGTGGCCGTACTGATCATTTTATTGAAGAAAGAAAATATGAAGCCCCACTTAATGTCTATGGCTACTCTAAATTCTTATTTGATGAATATGTGCGCCAAATTTTACCTGAAGCACAATCTATGGTGTGTGGTTTCCGTTATTTCAATGTGTATGGCCCCCGTGAAGGGCATAAAGGCAGTATGGCCAGTGTCGCCTTCCATTTAAATACACAAGTCAATGACGGGCAAAATCCCAAATTATTTGAAGGTAGTGAAACCTTCCAACGTGACTTTATTTATGTGGGGGATGTGGCTGCGGTTAATTTATGGTTCTGGCGCAACAATGTCTCCGGTATTTATAATTGTGGTACCGGCCGCGCAGAATCGTTCCAAGCCGTGGCTGATGCAGTTATCGCTTATCATAACGATAAAGATCTCTCTGTTGAGCATATTGAATTCCCTGAGAAACTCAAAGGTCGTTATCAAGCCTTTACACAAGCTGATCTGACAAATTTACGCAAAGCAGGCTACAGCGCCCCTTTTAAAACGGTCGCAGAAGGTGTTGCTCTTTATATGCAATGGTTAAATCAGGATAAGTAATCGCGGTTTATGAAAATTTTTGTGGTAGGGCCTTCTTGGGTTGGGGATAT