Homologs in group_2205

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_16315 FBDBKF_16315 92.9 Morganella morganii S1 rfaD ADP-glyceromanno-heptose 6-epimerase
EHELCC_16350 EHELCC_16350 92.9 Morganella morganii S2 rfaD ADP-glyceromanno-heptose 6-epimerase
NLDBIP_16990 NLDBIP_16990 92.9 Morganella morganii S4 rfaD ADP-glyceromanno-heptose 6-epimerase
LHKJJB_16910 LHKJJB_16910 92.9 Morganella morganii S3 rfaD ADP-glyceromanno-heptose 6-epimerase
HKOGLL_16930 HKOGLL_16930 92.9 Morganella morganii S5 rfaD ADP-glyceromanno-heptose 6-epimerase
PMI_RS15705 PMI_RS15705 82.1 Proteus mirabilis HI4320 rfaD ADP-glyceromanno-heptose 6-epimerase

Distribution of the homologs in the orthogroup group_2205

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2205

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
C6DIA9 0.0 553 85 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6DAT7 0.0 553 85 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B4F132 0.0 547 82 0 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Proteus mirabilis (strain HI4320)
Q7MY46 0.0 543 82 0 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A1JHX6 0.0 542 83 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B1JQW4 0.0 536 82 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66GC7 0.0 536 82 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TSC8 0.0 536 82 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Yersinia pestis (strain Pestoides F)
Q1CD11 0.0 536 82 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R683 0.0 536 82 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZJN4 0.0 536 82 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Yersinia pestis
B2JYP2 0.0 536 82 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C276 0.0 536 82 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FCU3 0.0 536 82 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q2NQV7 0.0 533 82 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Sodalis glossinidius (strain morsitans)
A7MQ91 0.0 530 80 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Cronobacter sakazakii (strain ATCC BAA-894)
A8ARK8 0.0 523 80 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A8GLC8 0.0 522 81 2 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Serratia proteamaculans (strain 568)
Q3YVY3 0.0 518 79 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Shigella sonnei (strain Ss046)
Q83PP2 0.0 518 79 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Shigella flexneri
Q0SYE8 0.0 518 79 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Shigella flexneri serotype 5b (strain 8401)
Q329N6 0.0 518 79 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Shigella dysenteriae serotype 1 (strain Sd197)
Q31V04 0.0 518 79 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Shigella boydii serotype 4 (strain Sb227)
B2U5D7 0.0 518 79 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1R4X2 0.0 518 79 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli (strain UTI89 / UPEC)
B7NES6 0.0 518 79 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q8FCA0 0.0 518 79 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TBI8 0.0 518 79 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AHF5 0.0 518 79 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli O1:K1 / APEC
B7N1S3 0.0 518 79 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli O81 (strain ED1a)
B7NPC7 0.0 518 79 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7MFI2 0.0 518 79 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli O45:K1 (strain S88 / ExPEC)
B1IZH2 0.0 518 79 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A683 0.0 518 79 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli O9:H4 (strain HS)
C5BB97 0.0 517 80 2 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Edwardsiella ictaluri (strain 93-146)
B5RGG8 0.0 517 78 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R5E3 0.0 517 78 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella enteritidis PT4 (strain P125109)
B5FLI8 0.0 517 78 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella dublin (strain CT_02021853)
B7LVH8 0.0 516 79 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B6I3J9 0.0 516 79 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli (strain SE11)
P67910 0.0 516 79 1 310 1 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli (strain K12)
B1X953 0.0 516 79 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli (strain K12 / DH10B)
C4ZXL1 0.0 516 79 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli (strain K12 / MC4100 / BW2952)
B7M4A5 0.0 516 79 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli O8 (strain IAI1)
B5YWC0 0.0 516 79 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli O157:H7 (strain EC4115 / EHEC)
P67911 0.0 516 79 1 310 1 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli O157:H7
B7L745 0.0 516 79 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli (strain 55989 / EAEC)
B7ULH4 0.0 516 79 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZTH2 0.0 516 79 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli O139:H28 (strain E24377A / ETEC)
P67912 0.0 516 78 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P67913 0.0 516 78 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella typhi
B4TZW1 0.0 516 78 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella schwarzengrund (strain CVM19633)
B5BHZ3 0.0 516 78 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella paratyphi A (strain AKU_12601)
A9MVL2 0.0 516 78 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PC05 0.0 516 78 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SXC1 0.0 516 78 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella newport (strain SL254)
B4T9A3 0.0 516 78 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella heidelberg (strain SL476)
B5EXC5 0.0 516 78 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella agona (strain SL483)
B1LK58 0.0 516 79 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli (strain SMS-3-5 / SECEC)
C0Q1V2 0.0 515 78 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella paratyphi C (strain RKS4594)
Q57IC3 0.0 515 78 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella choleraesuis (strain SC-B67)
A4W527 0.0 514 78 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Enterobacter sp. (strain 638)
B5XTI2 0.0 514 78 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Klebsiella pneumoniae (strain 342)
A9MKQ6 0.0 513 78 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A6TFL4 0.0 513 78 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q9XCA1 0.0 510 77 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Klebsiella pneumoniae
B2VL47 1.91e-180 503 76 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
B8F727 5.12e-176 491 75 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Glaesserella parasuis serovar 5 (strain SH0165)
A6VLD2 1.23e-174 488 76 2 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
B3GYT6 4.73e-174 486 74 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
B0BSD7 1.01e-173 486 74 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A3N308 1.01e-173 486 74 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
P45048 2.29e-172 482 76 2 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UIN9 4.92e-172 481 76 2 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Haemophilus influenzae (strain PittGG)
Q4QLI0 5.2e-172 481 76 2 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Haemophilus influenzae (strain 86-028NP)
B0UWU3 1.16e-170 478 73 2 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Histophilus somni (strain 2336)
Q0I569 1.16e-170 478 73 2 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Histophilus somni (strain 129Pt)
Q65WA7 1.23e-170 478 74 2 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q7VKK8 2.41e-168 473 72 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q9CL97 6.19e-164 461 73 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Pasteurella multocida (strain Pm70)
B5FFS9 1.94e-158 447 70 3 316 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Aliivibrio fischeri (strain MJ11)
Q5E8J9 2.52e-157 444 70 3 316 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Aliivibrio fischeri (strain ATCC 700601 / ES114)
A7MSM1 1.09e-156 443 70 3 316 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Vibrio campbellii (strain ATCC BAA-1116)
Q87T56 3.83e-155 439 70 3 315 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q8DE09 3.69e-154 436 71 3 315 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Vibrio vulnificus (strain CMCP6)
C3LQK1 4.61e-154 436 69 3 316 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Vibrio cholerae serotype O1 (strain M66-2)
Q06963 4.61e-154 436 69 3 316 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F3Z4 4.61e-154 436 69 3 316 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q7MPN6 2.59e-153 434 70 3 315 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Vibrio vulnificus (strain YJ016)
A4SHC0 1.34e-152 433 64 4 321 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Aeromonas salmonicida (strain A449)
C4K8I6 4.04e-152 431 66 1 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
A0KQV3 1.02e-151 431 64 4 320 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A1SRT6 1.14e-151 430 67 4 316 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q31FG4 3.14e-142 407 64 4 315 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q3A8K5 1.61e-139 399 64 5 317 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
B8CVJ3 2.1e-132 382 60 5 314 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Shewanella piezotolerans (strain WP3 / JCM 13877)
A1TYR6 1.62e-131 379 61 4 316 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q1R1N5 1.66e-131 379 59 5 320 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
A3QJB2 6.21e-131 378 61 5 314 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q98I52 5.52e-130 375 60 5 315 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q07W60 2.35e-127 369 59 5 314 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Shewanella frigidimarina (strain NCIMB 400)
Q5P2S1 3.64e-125 363 57 4 316 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q3J7X9 2.09e-123 358 56 5 317 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q47GJ3 6.71e-122 355 59 6 329 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Dechloromonas aromatica (strain RCB)
A1KBH4 9.23e-122 355 56 5 321 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Azoarcus sp. (strain BH72)
A9ADU8 3.49e-116 341 55 5 327 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia multivorans (strain ATCC 17616 / 249)
Q2SY18 9.74e-116 340 55 5 326 1 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q13VD0 1.2e-115 339 54 5 326 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Paraburkholderia xenovorans (strain LB400)
P0DMK5 1.92e-115 339 55 5 326 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia pseudomallei (strain K96243)
A3NC24 1.98e-115 339 55 5 326 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia pseudomallei (strain 668)
Q3JPY8 1.98e-115 339 55 5 326 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia pseudomallei (strain 1710b)
A3NXW3 1.98e-115 339 55 5 326 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia pseudomallei (strain 1106a)
A1V6L4 1.98e-115 339 55 5 326 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia mallei (strain SAVP1)
Q62M34 1.98e-115 339 55 5 326 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia mallei (strain ATCC 23344)
A2S4R1 1.98e-115 339 55 5 326 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia mallei (strain NCTC 10229)
A3MHP7 1.98e-115 339 55 5 326 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia mallei (strain NCTC 10247)
A4JCI2 2.05e-115 339 55 5 327 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q0BH85 2.87e-115 338 55 5 327 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q1BY20 3.65e-115 338 55 5 327 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia orbicola (strain AU 1054)
B1JXS7 3.65e-115 338 55 5 327 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia orbicola (strain MC0-3)
A0K5M9 3.65e-115 338 55 5 327 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia cenocepacia (strain HI2424)
B1YV41 5e-115 338 55 5 327 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia ambifaria (strain MC40-6)
Q39IF3 6.09e-115 338 55 5 327 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
B4EB34 7.57e-115 337 55 5 327 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
B2T625 9.02e-115 337 54 5 326 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q0A4T8 9.24e-115 337 54 4 311 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
I1WGR6 1.54e-114 337 55 5 326 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia pseudomallei (strain 1026b)
Q8Y0X8 1.66e-114 337 54 5 326 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
C0QZ84 7.02e-114 335 55 4 308 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Brachyspira hyodysenteriae (strain ATCC 49526 / WA1)
B2JF12 1.38e-113 334 54 5 327 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q1LQG2 1.31e-112 332 54 6 328 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
B2U894 1.83e-112 332 53 5 326 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Ralstonia pickettii (strain 12J)
B3R3C0 2.68e-111 328 53 5 330 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q0KDH0 4.06e-111 328 53 5 326 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q7NTL6 1.09e-108 322 53 6 327 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
A6V291 1.78e-108 321 53 6 327 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Pseudomonas aeruginosa (strain PA7)
Q12CM2 7.76e-108 320 54 6 330 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q9HYQ8 2.81e-107 318 52 6 327 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02QH1 3.38e-107 318 52 6 327 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Pseudomonas aeruginosa (strain UCBPP-PA14)
B1XVP6 5.35e-107 318 52 6 328 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Polynucleobacter necessarius subsp. necessarius (strain STIR1)
Q3SK74 9.41e-107 317 52 5 328 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Thiobacillus denitrificans (strain ATCC 25259)
A9IJJ7 9.28e-106 314 51 6 326 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
A1VR25 1.33e-105 314 53 6 331 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Polaromonas naphthalenivorans (strain CJ2)
A9M3Q7 1.01e-103 309 51 7 328 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Neisseria meningitidis serogroup C (strain 053442)
Q7W609 1.22e-103 309 51 6 326 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WGU9 1.22e-103 309 51 6 326 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7VZF5 1.24e-103 309 50 6 326 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q9JQX8 1.47e-103 309 51 7 328 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q9K002 1.83e-103 308 51 7 328 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q51061 6.34e-103 307 51 7 328 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Neisseria gonorrhoeae
A1KT78 1.12e-101 304 50 7 328 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q5F9J0 4.29e-101 303 50 6 328 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q21Y60 1.36e-97 294 49 7 336 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q2L2R8 4.43e-97 292 50 6 324 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Bordetella avium (strain 197N)
Q46Y59 3e-94 285 48 5 326 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q8RIA5 6.83e-74 233 43 7 322 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
A1VGB0 3.33e-71 226 42 7 317 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Nitratidesulfovibrio vulgaris (strain DP4)
Q72ET7 3.4e-71 226 42 7 317 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q57664 3.38e-25 105 33 13 266 3 MJ0211 Putative UDP-glucose 4-epimerase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q59083 1.64e-18 88 27 11 332 3 exoB UDP-glucose 4-epimerase Azospirillum brasilense
P33119 1.7e-12 70 28 11 275 3 galE UDP-glucose 4-epimerase Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
O34886 1.98e-12 70 25 12 296 3 ytcB Uncharacterized UDP-glucose epimerase YtcB Bacillus subtilis (strain 168)
Q564Q1 2.25e-12 70 27 11 287 1 gale-1 UDP-glucose 4-epimerase Caenorhabditis elegans
Q9SUN3 4.53e-12 69 27 11 281 2 At4g20460 Probable UDP-arabinose 4-epimerase 3 Arabidopsis thaliana
Q45291 4.7e-12 69 26 9 263 3 galE UDP-glucose 4-epimerase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
P21977 6.23e-12 68 25 11 331 3 galE UDP-glucose 4-epimerase Streptococcus thermophilus
D4GU72 7.6e-12 68 26 9 306 3 agl12 Low-salt glycan biosynthesis protein Agl12 Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
Q9FI17 1.81e-11 67 25 8 281 3 At5g44480 Putative UDP-arabinose 4-epimerase 4 Arabidopsis thaliana
Q59745 1.86e-11 67 25 11 286 3 exoB UDP-glucose 4-epimerase Rhizobium leguminosarum bv. trifolii
O64749 3.3e-11 67 26 10 296 2 At2g34850 Putative UDP-arabinose 4-epimerase 2 Arabidopsis thaliana
Q9SA77 4.7e-11 66 27 10 281 1 MUR4 UDP-arabinose 4-epimerase 1 Arabidopsis thaliana
P96995 5.75e-11 65 25 12 329 3 galE UDP-glucose 4-epimerase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q7WTB1 9.71e-11 65 29 11 275 2 galE UDP-glucose 4-epimerase Lactobacillus helveticus
P26503 1.35e-10 64 26 10 286 3 exoB UDP-glucose 4-epimerase Rhizobium meliloti (strain 1021)
Q9KDV3 1.36e-10 64 27 10 279 3 galE UDP-glucose 4-epimerase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
D4GU71 2.45e-10 63 26 7 242 3 agl14 Probable low-salt glycan biosynthesis reductase Agl14 Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
Q8H0B6 3.78e-10 63 26 10 284 2 UEL-2 Probable UDP-arabinose 4-epimerase 2 Oryza sativa subsp. japonica
Q42605 6.52e-10 62 27 15 293 1 UGE1 Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 1 Arabidopsis thaliana
Q8LDN8 1.05e-09 62 27 15 291 1 UGE3 Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 3 Arabidopsis thaliana
P13226 1.31e-09 62 26 10 267 3 galE UDP-glucose 4-epimerase Streptomyces lividans
Q04973 1.37e-09 62 25 15 326 3 vipB Vi polysaccharide biosynthesis protein VipB/TviC Salmonella typhi
Q8H0B2 1.56e-09 62 26 11 285 2 UEL-3 Probable UDP-arabinose 4-epimerase 3 Oryza sativa subsp. japonica
Q9HDU3 2.1e-09 62 28 15 287 3 gal10 Bifunctional protein gal10 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P47364 2.24e-09 61 25 13 285 3 galE UDP-glucose 4-epimerase Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q59678 2.35e-09 61 27 16 297 3 galE UDP-glucose 4-epimerase Mannheimia haemolytica
B0M3E8 3.4e-09 60 24 12 288 1 UGE1 Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 1 Pisum sativum
Q05026 4.35e-09 60 27 16 296 3 galE UDP-glucose 4-epimerase Neisseria gonorrhoeae
Q6K2E1 6.56e-09 60 25 9 279 2 UGE-4 UDP-glucose 4-epimerase 4 Oryza sativa subsp. japonica
Q9SN58 8.14e-09 59 27 11 283 1 UGE5 UDP-glucose 4-epimerase 5 Arabidopsis thaliana
O95455 9.05e-09 59 25 9 283 1 TGDS dTDP-D-glucose 4,6-dehydratase Homo sapiens
Q8LNZ3 1.24e-08 58 25 12 283 2 UGE-1 UDP-glucose 4-epimerase 1 Oryza sativa subsp. japonica
P55180 1.25e-08 58 29 9 187 3 galE UDP-glucose 4-epimerase Bacillus subtilis (strain 168)
A6QLW2 1.54e-08 58 25 10 285 2 TGDS dTDP-D-glucose 4,6-dehydratase Bos taurus
O84903 1.57e-08 58 29 14 283 3 galE UDP-glucose 4-epimerase Lacticaseibacillus casei
Q43070 1.83e-08 58 24 12 288 2 GALE UDP-glucose 4-epimerase Pisum sativum
Q8H930 2.95e-08 58 26 9 283 2 UEL-1 Probable UDP-arabinose 4-epimerase 1 Oryza sativa subsp. japonica
Q9CNY5 3.12e-08 57 27 15 302 3 galE UDP-glucose 4-epimerase Pasteurella multocida (strain Pm70)
P56986 3.69e-08 57 24 15 327 3 galE UDP-glucose 4-epimerase Neisseria meningitidis serogroup C
Q6ZDJ7 3.75e-08 57 26 13 281 2 UGE-2 UDP-glucose 4-epimerase 2 Oryza sativa subsp. japonica
O65780 4.37e-08 57 26 14 296 2 None UDP-glucose 4-epimerase GEPI42 Cyamopsis tetragonoloba
P04397 5.73e-08 57 25 16 327 1 GAL10 Bifunctional protein GAL10 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q553X7 6.15e-08 57 26 11 288 1 galE UDP-glucose 4-epimerase Dictyostelium discoideum
Q7BJX9 1.15e-07 56 24 12 324 1 wbgU UDP-N-acetylglucosamine 4-epimerase Plesiomonas shigelloides
P75517 1.23e-07 55 25 11 289 3 galE UDP-glucose 4-epimerase Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
P35673 1.36e-07 55 24 12 306 3 galE UDP-glucose 4-epimerase Erwinia amylovora
Q58455 1.59e-07 55 26 18 336 3 MJ1055 Uncharacterized protein MJ1055 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P56985 1.6e-07 55 23 14 327 3 galE UDP-glucose 4-epimerase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q8VDR7 1.78e-07 55 25 10 284 2 Tgds dTDP-D-glucose 4,6-dehydratase Mus musculus
Q9F7D4 2.04e-07 55 26 14 306 3 galE UDP-glucose 4-epimerase Yersinia pestis
P56997 2.35e-07 55 24 14 298 3 galE UDP-glucose 4-epimerase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
P22715 2.71e-07 55 24 15 310 3 galE UDP-glucose 4-epimerase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q56093 2.71e-07 55 24 15 310 3 galE UDP-glucose 4-epimerase Salmonella typhi
Q652A8 3.53e-07 54 25 14 281 2 UGE-3 UDP-glucose 4-epimerase 3 Oryza sativa subsp. japonica
F8C4X8 5.78e-07 53 27 10 254 1 TOPB45_0660 UDP-glucuronate 4-epimerase Thermodesulfobacterium geofontis (strain OPF15)
P24325 1.05e-06 53 25 12 294 3 galE UDP-glucose 4-epimerase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P09147 1.07e-06 53 24 16 311 1 galE UDP-glucose 4-epimerase Escherichia coli (strain K12)
Q9L9E9 1.68e-06 52 27 4 163 3 novS dTDP-4-keto-6-deoxy-D-glucose reductase Streptomyces niveus
P39858 1.8e-06 52 23 14 343 3 capI Protein CapI Staphylococcus aureus
O65781 2.48e-06 52 25 12 281 2 None UDP-glucose 4-epimerase GEPI48 Cyamopsis tetragonoloba
P21097 2.81e-06 52 28 13 237 2 OPG174 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase Vaccinia virus (strain Copenhagen)
P26670 3.49e-06 51 28 13 237 2 OPG174 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase Vaccinia virus (strain Western Reserve)
Q9C7W7 3.57e-06 51 25 11 279 1 UGE4 UDP-glucose 4-epimerase 4 Arabidopsis thaliana
O57245 3.58e-06 51 28 13 237 2 OPG174 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase Vaccinia virus (strain Ankara)
Q9W0P5 3.79e-06 51 25 15 328 1 Gale UDP-glucose 4-epimerase Drosophila melanogaster
Q6E7F2 7.8e-06 50 23 11 281 1 fcf1 dTDP-4-dehydro-6-deoxyglucose reductase Escherichia coli
A0A7H0DNE2 1.17e-05 50 28 13 237 2 OPG174 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase Monkeypox virus
E8MF10 1.24e-05 49 27 13 281 1 lnpD UDP-glucose 4-epimerase Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b)
P40801 1.63e-05 50 26 12 294 2 GAL10 Bifunctional protein GAL10 Pachysolen tannophilus
Q9ZAE8 5.73e-05 47 26 9 234 3 acbB dTDP-glucose 4,6-dehydratase Actinoplanes sp. (strain ATCC 31044 / CBS 674.73 / SE50/110)
A0A7L8UVC9 6.21e-05 48 24 2 123 3 ffsA Polyketide synthase-nonribosomal peptide synthetase ffsA Aspergillus flavipes
Q8VZC0 8.57e-05 47 25 11 263 1 UXS1 UDP-glucuronic acid decarboxylase 1 Arabidopsis thaliana
Q9LIS3 0.000171 46 23 10 239 1 GAE6 UDP-glucuronate 4-epimerase 6 Arabidopsis thaliana
A0QSK6 0.000254 45 26 8 225 1 rmlB dTDP-glucose 4,6-dehydratase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P44094 0.000264 45 22 5 162 1 denD D-erythronate dehydrogenase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P95780 0.000294 45 24 15 342 1 rmlB dTDP-glucose 4,6-dehydratase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
A2Z7B3 0.000306 45 23 12 298 2 OsI_032456 GDP-mannose 3,5-epimerase 1 Oryza sativa subsp. indica
Q5PQX0 0.000366 45 22 7 261 1 Uxs1 UDP-glucuronic acid decarboxylase 1 Rattus norvegicus
A3C4S4 0.000369 45 24 12 298 1 GME-1 GDP-mannose 3,5-epimerase 1 Oryza sativa subsp. japonica
Q91XL3 0.000442 45 22 7 261 1 Uxs1 UDP-glucuronic acid decarboxylase 1 Mus musculus
Q8NBZ7 0.000442 45 22 7 261 1 UXS1 UDP-glucuronic acid decarboxylase 1 Homo sapiens
Q5R885 0.000446 45 22 7 261 2 UXS1 UDP-glucuronic acid decarboxylase 1 Pongo abelii
Q6T1X6 0.000501 44 24 9 262 1 rmd GDP-6-deoxy-D-mannose reductase Aneurinibacillus thermoaerophilus
Q8WUS8 0.000522 45 24 11 242 1 SDR42E1 Short-chain dehydrogenase/reductase family 42E member 1 Homo sapiens
Q0P8I7 0.000544 44 25 8 188 1 Cj1427c GDP-D-glycero-alpha-D-manno-heptose dehydrogenase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q6DF08 0.000615 44 22 7 258 2 uxs1 UDP-glucuronic acid decarboxylase 1 Xenopus tropicalis

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS17275
Feature type CDS
Gene rfaD
Product ADP-glyceromanno-heptose 6-epimerase
Location 87549 - 88487 (strand: 1)
Length 939 (nucleotides) / 312 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000007
Length 196482 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2205
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01370 NAD dependent epimerase/dehydratase family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0451 Cell wall/membrane/envelope biogenesis (M) M Nucleoside-diphosphate-sugar epimerase

Kegg Ortholog Annotation(s)

Virulence factor Annotation(s)

VF gene ID Protein VF ID Category
VFG000332 ADP-L-glycero-D-mannoheptose-6-epimerase VF0044 Immune modulation

Protein Sequence

MIIVTGGAGFIGSNIVKALNDDGYTDILVVDNLKDGTKFVNLVDLDITDYIDKEDFIAGIIAGDDFGDIEAVFHEGACSSTTVWDGKYMMDNNYQYSKELLDYCMDRRIPFLYASSAATYGGRSDNFIEERQYEKPLNVYGYSKFLFDQHVRDVLPDAESQICGFRYFNVYGPREGHKGSMASVAFHLNNQISDGENPKLFSGSENFLRDFIYVGDVAAVNLWFWKNAKSGIFNCGTGRAESFQAVADAVTGFHSNRQCTLDYIEFPEKLKGRYQAYTQADLTNLRAAGYPGKFKTVAEGVHEYMIWLNQGN

Flanking regions ( +/- flanking 50bp)

ATCAGCGATTTTTTCATTTTCTTAAATGAACCCGAACAGAGGAATGCGTGATGATTATTGTCACCGGCGGTGCCGGATTTATCGGCAGCAATATTGTAAAAGCACTTAACGATGACGGTTACACTGATATTTTAGTGGTGGATAACCTGAAAGACGGCACAAAATTTGTGAATCTGGTTGATCTCGATATCACCGATTATATTGATAAAGAAGATTTTATTGCCGGTATTATTGCCGGGGATGATTTCGGAGATATCGAGGCTGTTTTCCATGAAGGCGCATGCTCTTCCACAACCGTGTGGGATGGTAAGTATATGATGGATAACAACTATCAATACTCCAAAGAGCTGCTGGATTATTGCATGGATCGCCGCATTCCGTTCCTGTATGCCTCTTCTGCCGCAACCTACGGCGGGCGCAGCGATAACTTTATTGAAGAGCGTCAGTATGAAAAACCATTAAATGTATATGGTTATTCAAAGTTCCTGTTTGACCAACATGTCCGCGATGTTCTGCCGGATGCAGAGTCACAGATCTGCGGGTTCCGCTATTTTAATGTTTATGGTCCGCGTGAAGGTCATAAAGGCAGCATGGCAAGCGTCGCTTTCCATCTTAATAACCAGATTTCAGATGGCGAAAACCCGAAATTATTCTCAGGAAGCGAAAATTTCCTGCGCGATTTCATCTATGTGGGTGATGTTGCCGCTGTTAATCTGTGGTTCTGGAAAAATGCCAAATCCGGAATTTTTAACTGCGGTACCGGTCGTGCAGAATCTTTTCAGGCTGTCGCTGATGCCGTAACCGGTTTCCACAGTAATCGTCAGTGCACACTTGATTACATTGAATTCCCGGAAAAACTCAAAGGCCGTTACCAGGCATATACGCAGGCTGATTTAACCAACCTGCGCGCGGCGGGCTATCCCGGCAAATTTAAAACCGTTGCCGAAGGTGTTCACGAATACATGATTTGGTTAAATCAGGGAAATTAAGTAAACACACATGAAAATTCTGGTGATCGGGCCATCGTGGGTCGGTGACA