Homologs in group_17

Help

15 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_18150 FBDBKF_18150 40.8 Morganella morganii S1 fimC P pilus assembly protein, chaperone PapD
EHELCC_10430 EHELCC_10430 100.0 Morganella morganii S2 fimC P pilus assembly protein, chaperone PapD
EHELCC_16850 EHELCC_16850 40.8 Morganella morganii S2 fimC P pilus assembly protein, chaperone PapD
NLDBIP_10775 NLDBIP_10775 100.0 Morganella morganii S4 fimC P pilus assembly protein, chaperone PapD
NLDBIP_17600 NLDBIP_17600 40.8 Morganella morganii S4 fimC P pilus assembly protein, chaperone PapD
LHKJJB_10580 LHKJJB_10580 100.0 Morganella morganii S3 fimC P pilus assembly protein, chaperone PapD
LHKJJB_17520 LHKJJB_17520 40.8 Morganella morganii S3 fimC P pilus assembly protein, chaperone PapD
HKOGLL_13640 HKOGLL_13640 100.0 Morganella morganii S5 fimC P pilus assembly protein, chaperone PapD
HKOGLL_17335 HKOGLL_17335 40.8 Morganella morganii S5 fimC P pilus assembly protein, chaperone PapD
F4V73_RS10355 F4V73_RS10355 39.5 Morganella psychrotolerans - molecular chaperone
F4V73_RS10985 F4V73_RS10985 82.1 Morganella psychrotolerans - fimbria/pilus periplasmic chaperone
PMI_RS01445 PMI_RS01445 45.6 Proteus mirabilis HI4320 - fimbria/pilus periplasmic chaperone
PMI_RS05170 PMI_RS05170 26.3 Proteus mirabilis HI4320 - fimbrial chaperone
PMI_RS09275 PMI_RS09275 43.7 Proteus mirabilis HI4320 - molecular chaperone
PMI_RS10940 PMI_RS10940 46.0 Proteus mirabilis HI4320 - fimbria/pilus periplasmic chaperone

Distribution of the homologs in the orthogroup group_17

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_17

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P77599 2.22e-78 239 52 1 213 2 yfcS Probable fimbrial chaperone YfcS Escherichia coli (strain K12)
P53520 1.11e-72 225 43 4 248 3 pmfD Chaperone protein PmfD Proteus mirabilis (strain HI4320)
P15319 3.97e-72 223 45 4 240 1 papD Chaperone protein PapD Escherichia coli
P75749 3.79e-53 175 40 6 243 3 ybgP Uncharacterized fimbrial chaperone YbgP Escherichia coli (strain K12)
P77616 1.28e-47 161 36 6 242 3 yqiH Uncharacterized fimbrial chaperone YqiH Escherichia coli (strain K12)
P21646 5.27e-33 122 36 9 228 3 mrkB Chaperone protein MrkB Klebsiella pneumoniae
Q8X5K6 1.36e-31 119 33 7 235 2 lpfB Probable fimbrial chaperone LpfB Escherichia coli O157:H7
P42914 1.09e-30 117 37 9 223 2 yraI Probable fimbrial chaperone YraI Escherichia coli (strain K12)
P33128 2.98e-30 116 34 11 252 1 yadV Probable fimbrial chaperone YadV Escherichia coli (strain K12)
P43661 2.76e-28 110 35 6 192 3 lpfB Chaperone protein LpfB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P31697 1.96e-27 108 33 9 227 1 fimC Chaperone protein FimC Escherichia coli (strain K12)
P59590 5.34e-26 104 33 12 242 3 fimC Chaperone protein FimC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P42183 9.24e-26 100 42 2 120 3 prsD Chaperone protein PrsD (Fragment) Escherichia coli
P33409 1.64e-25 103 32 11 244 3 fimB Chaperone protein FimB/FhaD Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P62609 5.48e-25 101 32 7 221 1 focC Chaperone protein FocC Escherichia coli
P62610 5.48e-25 101 32 7 221 3 focC Chaperone protein FocC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P45991 1.95e-24 100 32 7 225 3 hifB Chaperone protein HifB Haemophilus influenzae
P25401 2.08e-24 100 31 8 231 1 faeE Chaperone protein FaeE Escherichia coli
P75856 6.15e-24 99 30 6 223 2 elfD Probable fimbrial chaperone protein ElfD Escherichia coli (strain K12)
Q05433 2.29e-23 98 30 8 231 3 clpE Chaperone protein ClpE Escherichia coli
Q8X5E4 3.64e-23 97 29 6 223 2 elfD Probable fimbrial chaperone protein ElfD Escherichia coli O157:H7
P35757 1.96e-22 95 33 7 220 3 hifB Chaperone protein HifB Haemophilus influenzae
P33342 4.57e-22 94 32 10 230 2 yehC Probable fimbrial chaperone YehC Escherichia coli (strain K12)
P37923 4.25e-21 91 31 8 233 3 fimC Chaperone protein FimC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P25402 9.35e-19 85 30 9 230 3 fanE Chaperone protein FanE Escherichia coli
P77249 1.03e-18 85 32 5 181 2 sfmC Probable fimbrial chaperone SfmC Escherichia coli (strain K12)
P69966 1.71e-11 65 27 9 226 3 psaB Chaperone protein PsaB Yersinia pseudotuberculosis serotype I (strain IP32953)
P69965 1.71e-11 65 27 9 226 3 psaB Chaperone protein PsaB Yersinia pestis
P33407 1.09e-10 63 24 9 225 3 myfB Chaperone protein MyfB Yersinia enterocolitica
P33387 1.85e-10 62 27 5 169 3 sefB Chaperone protein SefB Salmonella enteritidis
P40876 5.11e-10 61 24 10 253 2 ycbF Uncharacterized fimbrial chaperone YcbF Escherichia coli (strain K12)
P53518 5.5e-10 61 27 7 184 3 cssC Chaperone protein CssC Escherichia coli
P53516 5.57e-10 61 27 10 198 3 afaB Chaperone protein AfaB Escherichia coli
P53519 2.39e-09 59 30 7 162 3 cssC Chaperone protein CssC Escherichia coli
P46004 1.12e-08 57 28 8 181 3 aggD Chaperone protein AggD Escherichia coli
P26926 1.15e-08 57 26 9 230 1 caf1M Chaperone protein caf1M Yersinia pestis
P15483 1.29e-07 54 29 9 174 3 None Chaperone protein CS3-1 Escherichia coli
P28722 2.02e-06 50 24 6 174 3 yhcA Uncharacterized fimbrial chaperone YhcA Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_08980
Feature type CDS
Gene fimC
Product P pilus assembly protein, chaperone PapD
Location 11391 - 12149 (strand: -1)
Length 759 (nucleotides) / 252 (amino acids)
In genomic island -

Contig

Accession contig_10
Length 146103 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_17
Orthogroup size 16
N. genomes 7

Actions

Genomic region

Domains

PF00345 Pili and flagellar-assembly chaperone, PapD N-terminal domain
PF02753 Pili assembly chaperone PapD, C-terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3121 Extracellular structures (W) W P pilus assembly protein, chaperone PapD

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K12519 chaperone protein PapD - -

Virulence factor Annotation(s)

VF gene ID Protein VF ID Category
VFG042634 MrfD VF1232 Adherence

Protein Sequence

MKNQYNRFTSRSLPVLILAGILAAPAGQAAIALDRTRVILNGSERAESVEISNQNKELPYLAQAWIEDAQGNKIKDPLVALPPIQRVEAGEKSQVKIQPTAAMKMLAQDKESLYYFNLREIPPKTDKANTLQIALQTRIKLFYRPAGLVVAQNAKPWQESITLTRQGDKYTVNNPTPYYVTISSASAAYKGKDISGFNALMIAPNSSEVLGGNAASLGSAPVLGYINDYGGRPKMIFACQGNTCRVSGVKPG

Flanking regions ( +/- flanking 50bp)

TCCCGTTGGCTGACAGATGCTGACGCGGAAAACACCAGAGAGAGTAAGCAATGAAGAATCAATACAACCGTTTTACTTCACGAAGCCTTCCGGTACTGATACTGGCCGGTATCCTGGCTGCGCCGGCAGGACAGGCGGCGATTGCACTGGACAGAACCCGTGTCATTTTAAACGGCAGTGAACGGGCAGAAAGTGTTGAAATTTCTAATCAGAATAAAGAGTTACCGTATCTGGCTCAGGCATGGATTGAAGATGCACAAGGTAACAAAATCAAAGATCCGCTGGTGGCGCTGCCGCCAATCCAGCGGGTGGAAGCCGGTGAAAAAAGCCAGGTAAAAATTCAGCCGACAGCGGCAATGAAGATGCTGGCGCAGGATAAAGAGAGTCTTTATTACTTTAATCTGCGGGAGATTCCGCCGAAAACGGACAAAGCCAACACATTGCAGATTGCCTTACAGACCCGTATCAAACTGTTTTATCGTCCGGCGGGCTTAGTGGTGGCGCAGAATGCAAAGCCATGGCAGGAGAGTATTACCCTGACACGGCAGGGGGATAAATACACGGTGAATAATCCGACACCGTATTACGTGACGATCTCCTCGGCATCGGCGGCTTATAAAGGAAAAGATATCAGCGGTTTCAATGCATTAATGATTGCGCCAAACAGCAGTGAAGTTCTCGGCGGCAATGCCGCATCACTGGGGAGTGCGCCGGTACTGGGTTACATCAATGATTACGGCGGTCGTCCGAAGATGATTTTTGCCTGTCAGGGCAATACCTGCCGGGTGAGTGGAGTCAAACCGGGCTGATGCGAAACCGCAGACCAGGAGCAGAGAAAGTGAAGAGATTCATTCCGTGT