Homologs in group_17

Help

15 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08980 FBDBKF_08980 40.8 Morganella morganii S1 fimC P pilus assembly protein, chaperone PapD
FBDBKF_18150 FBDBKF_18150 100.0 Morganella morganii S1 fimC P pilus assembly protein, chaperone PapD
EHELCC_10430 EHELCC_10430 40.8 Morganella morganii S2 fimC P pilus assembly protein, chaperone PapD
NLDBIP_10775 NLDBIP_10775 40.8 Morganella morganii S4 fimC P pilus assembly protein, chaperone PapD
NLDBIP_17600 NLDBIP_17600 100.0 Morganella morganii S4 fimC P pilus assembly protein, chaperone PapD
LHKJJB_10580 LHKJJB_10580 40.8 Morganella morganii S3 fimC P pilus assembly protein, chaperone PapD
LHKJJB_17520 LHKJJB_17520 100.0 Morganella morganii S3 fimC P pilus assembly protein, chaperone PapD
HKOGLL_13640 HKOGLL_13640 40.8 Morganella morganii S5 fimC P pilus assembly protein, chaperone PapD
HKOGLL_17335 HKOGLL_17335 100.0 Morganella morganii S5 fimC P pilus assembly protein, chaperone PapD
F4V73_RS10355 F4V73_RS10355 84.0 Morganella psychrotolerans - molecular chaperone
F4V73_RS10985 F4V73_RS10985 42.9 Morganella psychrotolerans - fimbria/pilus periplasmic chaperone
PMI_RS01445 PMI_RS01445 37.0 Proteus mirabilis HI4320 - fimbria/pilus periplasmic chaperone
PMI_RS05170 PMI_RS05170 31.2 Proteus mirabilis HI4320 - fimbrial chaperone
PMI_RS09275 PMI_RS09275 39.4 Proteus mirabilis HI4320 - molecular chaperone
PMI_RS10940 PMI_RS10940 43.3 Proteus mirabilis HI4320 - fimbria/pilus periplasmic chaperone

Distribution of the homologs in the orthogroup group_17

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_17

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P15319 3.5e-66 207 46 5 235 1 papD Chaperone protein PapD Escherichia coli
P77599 5.52e-63 200 46 3 216 2 yfcS Probable fimbrial chaperone YfcS Escherichia coli (strain K12)
P53520 4.27e-56 182 40 5 242 3 pmfD Chaperone protein PmfD Proteus mirabilis (strain HI4320)
P75749 2.55e-46 157 37 6 232 3 ybgP Uncharacterized fimbrial chaperone YbgP Escherichia coli (strain K12)
P77616 1.84e-44 152 34 6 244 3 yqiH Uncharacterized fimbrial chaperone YqiH Escherichia coli (strain K12)
P21646 3.66e-33 123 29 7 235 3 mrkB Chaperone protein MrkB Klebsiella pneumoniae
Q8X5K6 7.7e-33 122 33 11 230 2 lpfB Probable fimbrial chaperone LpfB Escherichia coli O157:H7
P59590 1.78e-32 121 34 9 233 3 fimC Chaperone protein FimC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P33409 3.52e-32 120 31 8 241 3 fimB Chaperone protein FimB/FhaD Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P31697 1.45e-31 119 34 9 233 1 fimC Chaperone protein FimC Escherichia coli (strain K12)
P37923 2.34e-31 118 34 8 222 3 fimC Chaperone protein FimC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P43661 5.87e-31 117 32 9 230 3 lpfB Chaperone protein LpfB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P62609 7.86e-31 117 37 9 206 1 focC Chaperone protein FocC Escherichia coli
P62610 7.86e-31 117 37 9 206 3 focC Chaperone protein FocC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P25401 2.32e-30 116 34 11 237 1 faeE Chaperone protein FaeE Escherichia coli
Q05433 4.27e-29 113 34 11 237 3 clpE Chaperone protein ClpE Escherichia coli
P33128 5.52e-28 110 33 8 236 1 yadV Probable fimbrial chaperone YadV Escherichia coli (strain K12)
P77249 5.71e-28 109 30 8 234 2 sfmC Probable fimbrial chaperone SfmC Escherichia coli (strain K12)
Q8X5E4 1.76e-27 108 32 10 235 2 elfD Probable fimbrial chaperone protein ElfD Escherichia coli O157:H7
P75856 2.55e-27 107 32 10 235 2 elfD Probable fimbrial chaperone protein ElfD Escherichia coli (strain K12)
P25402 1.92e-25 102 34 11 227 3 fanE Chaperone protein FanE Escherichia coli
P42914 9.03e-25 101 32 9 231 2 yraI Probable fimbrial chaperone YraI Escherichia coli (strain K12)
P45991 1.34e-24 100 31 10 242 3 hifB Chaperone protein HifB Haemophilus influenzae
P35757 2.15e-24 100 31 10 239 3 hifB Chaperone protein HifB Haemophilus influenzae
P33342 5.06e-23 96 30 7 211 2 yehC Probable fimbrial chaperone YehC Escherichia coli (strain K12)
P42183 7.34e-21 87 42 3 119 3 prsD Chaperone protein PrsD (Fragment) Escherichia coli
P46004 5.32e-15 75 30 11 215 3 aggD Chaperone protein AggD Escherichia coli
P53516 1.07e-14 74 31 8 200 3 afaB Chaperone protein AfaB Escherichia coli
P46738 4.57e-12 67 30 8 200 3 nfaE Chaperone protein NfaE Escherichia coli
P33407 1.99e-11 65 25 11 235 3 myfB Chaperone protein MyfB Yersinia enterocolitica
P26926 3.31e-11 64 27 9 221 1 caf1M Chaperone protein caf1M Yersinia pestis
P33387 5.88e-10 61 25 5 170 3 sefB Chaperone protein SefB Salmonella enteritidis
P15483 1.76e-09 59 30 10 197 3 None Chaperone protein CS3-1 Escherichia coli
P53519 2.71e-07 53 22 8 228 3 cssC Chaperone protein CssC Escherichia coli
P40876 4.52e-07 52 23 9 238 2 ycbF Uncharacterized fimbrial chaperone YcbF Escherichia coli (strain K12)
P69966 1.46e-06 51 25 10 227 3 psaB Chaperone protein PsaB Yersinia pseudotuberculosis serotype I (strain IP32953)
P69965 1.46e-06 51 25 10 227 3 psaB Chaperone protein PsaB Yersinia pestis
P53518 8.21e-06 48 20 9 232 3 cssC Chaperone protein CssC Escherichia coli

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_16850
Feature type CDS
Gene fimC
Product P pilus assembly protein, chaperone PapD
Location 29898 - 30632 (strand: -1)
Length 735 (nucleotides) / 244 (amino acids)
In genomic island -

Contig

Accession ZDB_230
Length 55766 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_17
Orthogroup size 16
N. genomes 7

Actions

Genomic region

Domains

PF00345 Pili and flagellar-assembly chaperone, PapD N-terminal domain
PF02753 Pili assembly chaperone PapD, C-terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3121 Extracellular structures (W) W P pilus assembly protein, chaperone PapD

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K12519 chaperone protein PapD - -

Protein Sequence

MRKVTTLFCAALTTLAAIPVTAGAAIALDRTRVIYNEGDKAVPLTVTNEHLSKPYLAQSWIENSTGQKITSPVFVTPPVQRIEPDRKSQIKVQLSPEAASLPADRESVFYLNVREIPPAVEKSNVLQIALQTKIKLFYRPKAIQVQEQMEKIAGADGIRLSQNGGQYTIENTTPYHLSVTRLDATGGKEVKFEPVMVSPKASASFSAPALGNAPVVYYVNDYGDSKPLKFSCAGSSCTVQSDSK

Flanking regions ( +/- flanking 50bp)

CCGGTATGTATTTTACAGAATTAACAGATGAATCCGTAAGGAACCTTAACATGAGAAAAGTGACCACCTTATTCTGCGCCGCACTGACCACCCTGGCCGCCATTCCGGTAACCGCGGGAGCCGCCATCGCACTCGACAGAACCCGTGTTATTTATAACGAAGGTGATAAAGCTGTGCCGCTGACGGTCACCAATGAGCACCTCAGCAAACCGTATCTGGCGCAGTCCTGGATTGAGAACAGCACCGGACAGAAAATCACATCACCGGTATTTGTCACTCCGCCGGTGCAGCGGATTGAGCCTGACCGCAAAAGCCAGATTAAAGTGCAGCTCTCTCCGGAAGCCGCCTCATTACCGGCTGACCGCGAATCGGTCTTTTATCTGAACGTCCGTGAAATTCCGCCGGCCGTTGAGAAAAGCAACGTGCTGCAAATTGCCCTGCAAACCAAGATCAAACTGTTCTACCGCCCGAAAGCGATTCAGGTTCAGGAGCAGATGGAAAAAATCGCCGGTGCGGATGGCATCCGTCTGTCACAGAATGGCGGGCAGTACACCATTGAAAACACCACGCCGTACCATCTTTCAGTCACTCGTCTGGATGCCACCGGCGGAAAAGAAGTGAAATTTGAGCCGGTGATGGTATCACCAAAAGCCTCCGCGTCCTTCAGTGCTCCGGCGCTGGGTAATGCGCCGGTTGTTTATTACGTCAATGACTACGGTGATAGCAAACCACTGAAATTCAGCTGTGCCGGCAGCAGCTGTACCGTGCAGTCAGACAGTAAATAATTAACAGGAGGAACCGCCGATGACACTGACCATGCTTTTCCGTACCGGCT