Homologs in group_283

Help

7 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06280 FBDBKF_06280 36.6 Morganella morganii S1 folA type 3 dihydrofolate reductase
EHELCC_09325 EHELCC_09325 36.6 Morganella morganii S2 folA type 3 dihydrofolate reductase
NLDBIP_09705 NLDBIP_09705 36.6 Morganella morganii S4 folA type 3 dihydrofolate reductase
LHKJJB_08050 LHKJJB_08050 36.6 Morganella morganii S3 folA type 3 dihydrofolate reductase
HKOGLL_07600 HKOGLL_07600 36.6 Morganella morganii S5 folA type 3 dihydrofolate reductase
F4V73_RS15640 F4V73_RS15640 36.6 Morganella psychrotolerans folA type 3 dihydrofolate reductase
PMI_RS11560 PMI_RS11560 35.1 Proteus mirabilis HI4320 folA type 3 dihydrofolate reductase

Distribution of the homologs in the orthogroup group_283

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_283

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ABQ6 5.72e-27 102 39 3 128 3 folA Dihydrofolate reductase Shigella flexneri
P0ABQ4 5.72e-27 102 39 3 128 1 folA Dihydrofolate reductase Escherichia coli (strain K12)
P0ABQ5 5.72e-27 102 39 3 128 3 folA Dihydrofolate reductase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P12833 1.93e-26 100 40 2 128 1 dhfrIII Dihydrofolate reductase type 3 Salmonella typhimurium
P31073 2.46e-26 100 40 3 128 3 folA Dihydrofolate reductase Citrobacter freundii
P31074 1.87e-25 98 39 3 128 3 folA Dihydrofolate reductase Klebsiella aerogenes
Q5V600 1.08e-23 94 39 3 133 3 folA2 Dihydrofolate reductase 2 Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
P43791 3.82e-23 92 35 4 146 3 folA Dihydrofolate reductase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P11045 9.43e-22 89 34 4 164 1 dfrA Dihydrofolate reductase Bacillus subtilis (strain 168)
Q59408 7.65e-21 86 37 2 129 3 dfrA13 Dihydrofolate reductase type A13 Escherichia coli
Q89AV2 8.59e-21 86 34 2 127 3 folA Dihydrofolate reductase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P57243 1.11e-20 85 35 5 147 3 folA Dihydrofolate reductase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q9UWQ4 1.69e-20 86 38 3 135 1 hdrB Dihydrofolate reductase HdrB Haloferax volcanii
P04174 1.91e-19 82 36 3 128 1 folA Dihydrofolate reductase Neisseria gonorrhoeae
Q54277 1.87e-18 80 33 2 128 1 dfrD Dihydrofolate reductase Staphylococcus haemolyticus
P0A017 2.22e-18 80 36 2 126 1 folA Dihydrofolate reductase Staphylococcus aureus
Q6GGY1 2.22e-18 80 36 2 126 3 folA Dihydrofolate reductase Staphylococcus aureus (strain MRSA252)
P99079 2.22e-18 80 36 2 126 1 folA Dihydrofolate reductase Staphylococcus aureus (strain N315)
P0A016 2.22e-18 80 36 2 126 3 folA Dihydrofolate reductase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HFZ7 2.22e-18 80 36 2 126 3 folA Dihydrofolate reductase Staphylococcus aureus (strain COL)
Q9U8B8 3.41e-18 80 34 6 146 1 DHFR Dihydrofolate reductase Heliothis virescens
Q8NWQ9 8.89e-18 78 36 2 126 3 folA Dihydrofolate reductase Staphylococcus aureus (strain MW2)
Q6G9D5 8.89e-18 78 36 2 126 3 folA Dihydrofolate reductase Staphylococcus aureus (strain MSSA476)
P0C0P1 1.71e-17 77 34 2 126 3 folA Dihydrofolate reductase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HPB1 1.71e-17 77 34 2 126 3 folA Dihydrofolate reductase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P0C0P0 1.71e-17 77 34 2 126 1 folA Dihydrofolate reductase Staphylococcus epidermidis
P13955 1.76e-17 77 34 2 126 1 dfrA Dihydrofolate reductase type 1 from Tn4003 Staphylococcus aureus
Q8K9Z8 3.84e-17 77 36 5 132 3 folA Dihydrofolate reductase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q9JSQ9 1.2e-16 75 35 3 128 3 folA Dihydrofolate reductase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q9K168 1.28e-16 75 35 3 128 3 folA Dihydrofolate reductase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q54801 2.21e-16 75 30 4 153 1 dhfR Dihydrofolate reductase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q9CBW1 1.34e-15 72 34 3 123 3 folA Dihydrofolate reductase Mycobacterium leprae (strain TN)
P0ABQ8 1.84e-15 72 32 7 170 3 dhfrVIII Dihydrofolate reductase type 8 Shigella sonnei
P0ABQ7 1.84e-15 72 32 7 170 3 dhfrVIII Dihydrofolate reductase type 8 Escherichia coli
P27421 3.12e-15 72 30 7 152 3 DHFR Viral dihydrofolate reductase Saimiriine herpesvirus 2 (strain 484-77)
G4VJD6 7.4e-15 71 31 6 147 1 DHFR Dihydrofolate reductase Schistosoma mansoni
Q920D2 7.7e-15 71 34 7 147 1 Dhfr Dihydrofolate reductase Rattus norvegicus
Q27828 2.51e-14 72 39 4 108 3 GSPATT00019973001 Bifunctional dihydrofolate reductase-thymidylate synthase Paramecium tetraurelia
P00377 2.78e-14 70 33 7 147 1 DHFR Dihydrofolate reductase Sus scrofa
P28019 4.1e-14 69 28 7 155 3 DHFR Dihydrofolate reductase Aedes albopictus
P00375 5.78e-14 69 33 7 147 1 Dhfr Dihydrofolate reductase Mus musculus
P04753 6.49e-14 68 32 7 147 2 DHFR Dihydrofolate reductase Mesocricetus auratus
P17719 1.47e-13 68 31 6 143 1 Dhfr Dihydrofolate reductase Drosophila melanogaster
P22573 1.79e-13 68 30 7 152 3 DHFR Viral dihydrofolate reductase Saimiriine herpesvirus 2 (strain 488)
P22906 2.15e-13 67 32 7 146 1 DFR1 Dihydrofolate reductase Candida albicans
P00374 3.35e-13 67 31 7 147 1 DHFR Dihydrofolate reductase Homo sapiens
P00376 4.35e-13 67 31 7 147 1 DHFR Dihydrofolate reductase Bos taurus
P9WNX1 5.72e-13 65 31 3 129 1 folA Dihydrofolate reductase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WNX0 5.72e-13 65 31 3 129 3 folA Dihydrofolate reductase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A547 5.72e-13 65 31 3 129 3 folA Dihydrofolate reductase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P09503 6.54e-13 66 31 7 147 3 DHFR Viral dihydrofolate reductase Saimiriine herpesvirus 2 (strain 11)
P00378 6.84e-13 66 34 7 144 1 DHFR Dihydrofolate reductase Gallus gallus
Q9PR30 7.72e-13 65 30 4 133 3 folA Dihydrofolate reductase Ureaplasma parvum serovar 3 (strain ATCC 700970)
P78028 1.09e-12 65 34 2 123 3 folA Dihydrofolate reductase Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q59397 1.15e-12 65 27 3 134 3 dhfrIX Dihydrofolate reductase type 9 Escherichia coli
P00380 4.62e-12 63 34 5 123 1 folA Dihydrofolate reductase Enterococcus faecium
P45350 4.8e-12 66 31 6 153 2 None Bifunctional dihydrofolate reductase-thymidylate synthase Daucus carota
Q5V3R2 7.47e-12 63 28 5 154 3 folA1 Dihydrofolate reductase 1 Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
Q05763 1.19e-11 65 33 5 151 2 THY-2 Bifunctional dihydrofolate reductase-thymidylate synthase 2 Arabidopsis thaliana
Q86XF0 1.42e-11 62 31 8 147 1 DHFR2 Dihydrofolate reductase 2, mitochondrial Homo sapiens
P16184 1.49e-11 63 29 6 153 1 None Dihydrofolate reductase Pneumocystis carinii
Q05762 3.74e-11 63 33 5 145 1 THY-1 Bifunctional dihydrofolate reductase-thymidylate synthase 1 Arabidopsis thaliana
P95524 3.95e-11 60 33 4 137 3 dhfrVI Dihydrofolate reductase type 6 Proteus mirabilis
P51820 4.42e-11 63 30 5 151 1 None Bifunctional dihydrofolate reductase-thymidylate synthase Glycine max
P47470 5.78e-11 60 30 3 136 3 folA Dihydrofolate reductase Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
O81395 8.47e-11 62 30 5 151 2 DRTS Bifunctional dihydrofolate reductase-thymidylate synthase Zea mays
Q98Q32 8.89e-11 60 29 4 134 3 folA Dihydrofolate reductase Mycoplasmopsis pulmonis (strain UAB CTIP)
Q2HRC6 8.93e-11 61 32 7 152 3 ORF2 Putative Dihydrofolate reductase Human herpesvirus 8 type P (isolate GK18)
P00381 9.65e-11 60 35 2 107 1 folA Dihydrofolate reductase Lacticaseibacillus casei
P11731 1.27e-10 59 33 5 129 1 dhfrV Dihydrofolate reductase type 5 Escherichia coli
Q93341 2.44e-10 59 32 4 117 3 dhfr-1 Putative dihydrofolate reductase Caenorhabditis elegans
P78218 4.45e-10 58 31 6 147 3 dhfrXV Dihydrofolate reductase type 15 Escherichia coli
Q07801 8.38e-10 58 30 4 124 1 DFR1 Dihydrofolate reductase Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)
P75478 8.42e-10 59 32 1 121 3 scpA Segregation and condensation protein A Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
P15093 9.85e-10 57 31 3 128 1 hdrA Dihydrofolate reductase HdrA Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
O62583 1.18e-09 57 27 5 151 3 DHFR-1 Dihydrofolate reductase Encephalitozoon cuniculi (strain GB-M1)
P07807 3.13e-09 57 26 7 168 1 DFR1 Dihydrofolate reductase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P16126 5.33e-09 57 27 6 167 3 None Bifunctional dihydrofolate reductase-thymidylate synthase Leishmania amazonensis
P00382 1.05e-08 54 31 7 151 1 dhfrI Dihydrofolate reductase type 1 Escherichia coli
Q2QRX6 2.44e-08 55 31 6 143 3 Os12g0446900 Putative bifunctional dihydrofolate reductase-thymidylate synthase Oryza sativa subsp. japonica
P36591 2.79e-08 55 27 8 168 2 dfr1 Dihydrofolate reductase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P07382 6.87e-08 53 26 6 167 1 LmjF06.0860 Bifunctional dihydrofolate reductase-thymidylate synthase Leishmania major
Q27783 1e-07 53 29 4 139 1 None Bifunctional dihydrofolate reductase-thymidylate synthase Trypanosoma brucei brucei
Q7NB76 4.05e-07 52 25 2 127 3 scpA Segregation and condensation protein A Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
P27422 1.17e-06 48 27 3 130 3 dhfrVII Dihydrofolate reductase type 7 Escherichia coli
Q27793 2.12e-06 49 27 7 176 1 None Bifunctional dihydrofolate reductase-thymidylate synthase Trypanosoma cruzi
O02604 1.46e-05 47 35 5 102 1 None Bifunctional dihydrofolate reductase-thymidylate synthase Plasmodium vivax
Q60034 1.96e-05 45 40 4 90 1 folA Dihydrofolate reductase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q59487 3.99e-05 45 27 4 135 3 folA Dihydrofolate reductase Lactococcus lactis subsp. lactis (strain IL1403)
Q5UQG3 0.000185 44 25 9 175 3 MIMI_R497 Bifunctional dihydrofolate reductase-thymidylate synthase Acanthamoeba polyphaga mimivirus

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS17885
Feature type CDS
Gene -
Product dihydrofolate reductase
Location 19299 - 19784 (strand: -1)
Length 486 (nucleotides) / 161 (amino acids)

Contig

Accession term accessions NZ_VXKB01000008 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 103951 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_283
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF00186 Dihydrofolate reductase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0262 Coenzyme transport and metabolism (H) H Dihydrofolate reductase

Kegg Ortholog Annotation(s)

Protein Sequence

MISLIAAVGRNNGIGVNNALPWRCSRDLKLFRKKTLGEIVVMGRKTAESLGKPLKDRFNFVLTRNPEKVPPGFAIIRNIDDVVALGDLHTVYVIGGAEIYRQFIGLAQRAFVSHIETDAADADTFFPMDELRAEFNRKMTLNFYDETDTEPAFDHVMYWKQ

Flanking regions ( +/- flanking 50bp)

CGAAACCACCAGCACCGGCCGACTGTTTACACCGTAACGCGGGGGGTATCTTGATTTCACTGATTGCAGCGGTCGGAAGAAATAACGGCATCGGCGTGAATAACGCCCTGCCCTGGCGTTGCTCCCGGGATCTGAAACTGTTCCGCAAAAAGACGCTTGGCGAGATTGTTGTTATGGGTCGTAAGACGGCGGAAAGTCTCGGGAAGCCGCTGAAAGACAGATTCAATTTTGTTCTGACACGTAACCCTGAAAAAGTACCGCCCGGCTTTGCAATCATCCGCAATATCGACGATGTGGTGGCGCTGGGCGACCTGCACACCGTTTACGTTATCGGTGGCGCGGAGATTTACCGGCAGTTCATCGGATTGGCACAACGCGCTTTCGTTTCCCATATTGAAACGGATGCGGCTGATGCTGATACCTTTTTCCCGATGGACGAGCTGCGGGCTGAGTTTAACCGAAAAATGACTCTTAACTTTTACGATGAAACAGACACCGAACCGGCGTTTGATCACGTCATGTACTGGAAGCAGTAATATGAAATCAGCATTTAAAATCGGGATTTGTGGCGCTCAGGGGGCTGGAA