Homologs in group_108

Help

10 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_01290 FBDBKF_01290 36.2 Morganella morganii S1 tssB type VI secretion system contractile sheath small subunit
EHELCC_00255 EHELCC_00255 36.2 Morganella morganii S2 tssB type VI secretion system contractile sheath small subunit
NLDBIP_03205 NLDBIP_03205 36.2 Morganella morganii S4 tssB type VI secretion system contractile sheath small subunit
LHKJJB_04720 LHKJJB_04720 36.2 Morganella morganii S3 tssB type VI secretion system contractile sheath small subunit
HKOGLL_02325 HKOGLL_02325 36.2 Morganella morganii S5 tssB type VI secretion system contractile sheath small subunit
F4V73_RS00095 F4V73_RS00095 26.1 Morganella psychrotolerans tssB type VI secretion system contractile sheath small subunit
F4V73_RS02380 F4V73_RS02380 36.8 Morganella psychrotolerans tssB type VI secretion system contractile sheath small subunit
F4V73_RS07025 F4V73_RS07025 29.6 Morganella psychrotolerans tssB type VI secretion system contractile sheath small subunit
F4V73_RS09365 F4V73_RS09365 26.5 Morganella psychrotolerans tssB type VI secretion system contractile sheath small subunit
PMI_RS03685 PMI_RS03685 39.6 Proteus mirabilis HI4320 tssB type VI secretion system contractile sheath small subunit

Distribution of the homologs in the orthogroup group_108

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_108

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q9I749 5.53e-15 71 31 3 144 1 tssB1 Type VI secretion system sheath protein TssB1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS16870
Feature type CDS
Gene tssB
Product type VI secretion system contractile sheath small subunit
Location 203351 - 203848 (strand: -1)
Length 498 (nucleotides) / 165 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000006
Length 212134 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_108
Orthogroup size 11
N. genomes 7

Actions

Genomic region

Domains

PF05591 Type VI secretion system, VipA, VC_A0107 or Hcp2

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3516 Intracellular trafficking, secretion, and vesicular transport (U) U Predicted component TssA of the type VI protein secretion system

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K11901 type VI secretion system protein ImpB Biofilm formation - Pseudomonas aeruginosa -

Virulence factor Annotation(s)

VF gene ID Protein VF ID Category
VFG048624 type VI secretion system contractile sheath small subunit VipA VF0569 Effector delivery system

Protein Sequence

MSDSFQNEVPKARINIKLDLHTGGAQKKVELPLKLLAVGDYSNGQDSRPLSEREKVNVNKNNFNSVLAEFNPTVNLTVKNTLTPEGAEENISISFKDMKDFEPEQVARQIPQLRAMLAMRNLLRDLKSNLLDNVTFRRELENILKDPALSNELRNELSELAPKKD

Flanking regions ( +/- flanking 50bp)

TTGCGTGAGATTAAAACTTGTAATTCCAGGTAAGAATAAGGATTTATGCTATGTCGGACAGCTTTCAGAATGAAGTACCCAAAGCCCGTATTAATATAAAACTCGATTTACACACCGGAGGTGCTCAGAAAAAAGTCGAACTCCCTCTTAAATTGCTTGCAGTTGGTGATTACAGTAACGGGCAGGATTCCCGCCCGCTGTCTGAGCGCGAAAAAGTCAATGTGAATAAAAATAACTTCAATAGTGTCCTCGCTGAATTTAATCCCACCGTTAATCTGACTGTCAAAAATACCCTCACGCCTGAGGGCGCAGAAGAAAATATTTCTATTTCATTCAAGGATATGAAGGATTTTGAACCGGAACAGGTCGCCCGTCAGATCCCTCAGTTACGGGCAATGCTGGCGATGCGCAATCTCCTGCGTGATTTGAAATCAAACCTGCTTGATAACGTCACTTTCCGTCGCGAACTGGAAAACATTCTGAAGGACCCGGCGCTCAGTAATGAATTGCGCAATGAGCTTTCTGAATTGGCACCGAAAAAAGACTAATTGGATTAAATACTTACAGGATGATGATGCTGATGTCTGTCAATAATGAA