Homologs in group_27

Help

13 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00870 FBDBKF_00870 26.3 Morganella morganii S1 higA Antitoxin HigA
FBDBKF_19620 FBDBKF_19620 19.4 Morganella morganii S1 hipB Transcriptional regulator, contains XRE-family HTH domain
EHELCC_00675 EHELCC_00675 26.3 Morganella morganii S2 higA Antitoxin HigA
EHELCC_16910 EHELCC_16910 19.4 Morganella morganii S2 hipB Transcriptional regulator, contains XRE-family HTH domain
NLDBIP_02785 NLDBIP_02785 26.3 Morganella morganii S4 higA Antitoxin HigA
NLDBIP_17540 NLDBIP_17540 19.4 Morganella morganii S4 hipB Transcriptional regulator, contains XRE-family HTH domain
LHKJJB_04300 LHKJJB_04300 26.3 Morganella morganii S3 higA Antitoxin HigA
LHKJJB_17460 LHKJJB_17460 19.4 Morganella morganii S3 hipB Transcriptional regulator, contains XRE-family HTH domain
HKOGLL_02745 HKOGLL_02745 26.3 Morganella morganii S5 higA Antitoxin HigA
HKOGLL_17275 HKOGLL_17275 19.4 Morganella morganii S5 hipB Transcriptional regulator, contains XRE-family HTH domain
F4V73_RS06860 F4V73_RS06860 22.4 Morganella psychrotolerans - XRE family transcriptional regulator
F4V73_RS13455 F4V73_RS13455 27.6 Morganella psychrotolerans - XRE family transcriptional regulator
PMI_RS15475 PMI_RS15475 41.0 Proteus mirabilis HI4320 - helix-turn-helix domain-containing protein

Distribution of the homologs in the orthogroup group_27

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_27

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P23873 1.56e-15 67 40 1 83 1 hipB Antitoxin HipB Escherichia coli (strain K12)
Q8FHF3 1.02e-14 65 39 1 83 3 hipB Antitoxin HipB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P9WJA7 1.03e-07 49 36 0 73 1 higA1 Antitoxin HigA1 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WJA6 1.03e-07 49 36 0 73 3 higA1 Antitoxin HigA1 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P14307 0.000673 38 37 0 53 4 None Control protein C.SmaI Serratia marcescens
P13772 0.001 37 33 0 60 4 None ImmF control region 10 kDa protein Bacillus phage phi105

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS10155
Feature type CDS
Gene -
Product helix-turn-helix domain-containing protein
Location 142506 - 142757 (strand: -1)
Length 252 (nucleotides) / 83 (amino acids)
In genomic island GI65

Contig

Accession NZ_VXKB01000002
Length 573139 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_27
Orthogroup size 14
N. genomes 7

Actions

Genomic region

Domains

PF01381 Helix-turn-helix

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3620 Transcription (K) K Predicted transcriptional regulator, contains an XRE-type HTH domain (archaeal members contain CBS pair)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K15773 HTH-type transcriptional regulator / antitoxin HipB - -

Protein Sequence

MKVTSPAALANAVRDQRKISKMSQTQTAELIGIKQTTVSDFENKPESTKLETLFKILAALDLELHVTKRGSTPDEKKTWNKEW

Flanking regions ( +/- flanking 50bp)

TTTATCCTCCACAGGGGATAACATTGTAATATCCGCCATAGGGGATAAAAATGAAAGTCACATCACCGGCTGCACTGGCTAATGCCGTCAGAGATCAACGAAAGATCAGTAAGATGAGTCAGACTCAGACTGCTGAGCTGATTGGTATCAAACAGACAACCGTTTCTGATTTCGAGAATAAACCGGAATCCACTAAGCTGGAAACATTGTTCAAAATCCTTGCCGCTCTGGATCTGGAGCTTCATGTTACGAAACGTGGCTCAACTCCGGATGAGAAAAAAACATGGAATAAGGAGTGGTAAGGAATGAAAACACAGGCACTGACAGTCGCCATGAACGGCGATGTGGTAGG