Homologs in group_27

Help

13 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00870 FBDBKF_00870 82.0 Morganella morganii S1 higA Antitoxin HigA
FBDBKF_19620 FBDBKF_19620 31.6 Morganella morganii S1 hipB Transcriptional regulator, contains XRE-family HTH domain
EHELCC_00675 EHELCC_00675 82.0 Morganella morganii S2 higA Antitoxin HigA
EHELCC_16910 EHELCC_16910 31.6 Morganella morganii S2 hipB Transcriptional regulator, contains XRE-family HTH domain
NLDBIP_02785 NLDBIP_02785 82.0 Morganella morganii S4 higA Antitoxin HigA
NLDBIP_17540 NLDBIP_17540 31.6 Morganella morganii S4 hipB Transcriptional regulator, contains XRE-family HTH domain
LHKJJB_04300 LHKJJB_04300 82.0 Morganella morganii S3 higA Antitoxin HigA
LHKJJB_17460 LHKJJB_17460 31.6 Morganella morganii S3 hipB Transcriptional regulator, contains XRE-family HTH domain
HKOGLL_02745 HKOGLL_02745 82.0 Morganella morganii S5 higA Antitoxin HigA
HKOGLL_17275 HKOGLL_17275 31.6 Morganella morganii S5 hipB Transcriptional regulator, contains XRE-family HTH domain
F4V73_RS10155 F4V73_RS10155 22.4 Morganella psychrotolerans - helix-turn-helix domain-containing protein
F4V73_RS13455 F4V73_RS13455 44.4 Morganella psychrotolerans - XRE family transcriptional regulator
PMI_RS15475 PMI_RS15475 25.6 Proteus mirabilis HI4320 - helix-turn-helix domain-containing protein

Distribution of the homologs in the orthogroup group_27

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_27

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P9WJA7 2e-11 59 47 0 59 1 higA1 Antitoxin HigA1 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WJA6 2e-11 59 47 0 59 3 higA1 Antitoxin HigA1 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O53467 0.000575 39 34 2 81 1 higA2 Putative antitoxin HigA2 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS06860
Feature type CDS
Gene -
Product XRE family transcriptional regulator
Location 1421101 - 1421403 (strand: -1)
Length 303 (nucleotides) / 100 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_27
Orthogroup size 14
N. genomes 7

Actions

Genomic region

Domains

PF13560 Helix-turn-helix domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3620 Transcription (K) K Predicted transcriptional regulator, contains an XRE-type HTH domain (archaeal members contain CBS pair)

Protein Sequence

MGKSLEQLLADETPEVVADAKAMATEILLNIHLAQLRERVQKTQVEMAQALGIKQPTVAGMEKPGRDLKLSTLRRYVDAIGGKLNIDIELPDGSHHTFIV

Flanking regions ( +/- flanking 50bp)

GATCGGGAGTTCACTGACTGGCTGAATGCACTAAAGAACAGGAGGTAAAGATGGGGAAATCACTGGAGCAACTGCTTGCAGATGAAACACCTGAAGTGGTCGCTGATGCAAAAGCGATGGCAACAGAGATATTGCTTAATATCCACCTTGCGCAGTTGCGGGAGCGGGTACAAAAAACCCAGGTGGAAATGGCACAGGCGCTGGGAATCAAGCAACCAACGGTTGCCGGAATGGAAAAACCGGGGCGTGACCTGAAATTATCGACACTCAGACGCTATGTTGATGCGATAGGCGGTAAACTGAATATTGATATTGAACTGCCGGATGGTTCACATCATACATTTATAGTGTGAAAAATAAGGGATTTACTAATAGATCCGGACAGGAACGCAGGGTAAATTAA