Homologs in group_174

Help

8 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00870 FBDBKF_00870 25.6 Morganella morganii S1 higA Antitoxin HigA
EHELCC_00675 EHELCC_00675 25.6 Morganella morganii S2 higA Antitoxin HigA
NLDBIP_02785 NLDBIP_02785 25.6 Morganella morganii S4 higA Antitoxin HigA
LHKJJB_04300 LHKJJB_04300 25.6 Morganella morganii S3 higA Antitoxin HigA
HKOGLL_02745 HKOGLL_02745 25.6 Morganella morganii S5 higA Antitoxin HigA
F4V73_RS06860 F4V73_RS06860 25.6 Morganella psychrotolerans - XRE family transcriptional regulator
F4V73_RS10155 F4V73_RS10155 41.0 Morganella psychrotolerans - helix-turn-helix domain-containing protein
F4V73_RS13455 F4V73_RS13455 25.6 Morganella psychrotolerans - XRE family transcriptional regulator

Distribution of the homologs in the orthogroup group_174

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_174

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8FHF3 5.21e-14 64 44 2 84 3 hipB Antitoxin HipB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P23873 8.36e-14 63 44 2 84 1 hipB Antitoxin HipB Escherichia coli (strain K12)
P9WJA7 2.14e-05 43 41 0 46 1 higA1 Antitoxin HigA1 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WJA6 2.14e-05 43 41 0 46 3 higA1 Antitoxin HigA1 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS15475
Feature type CDS
Gene -
Product helix-turn-helix domain-containing protein
Location 3440802 - 3441059 (strand: -1)
Length 258 (nucleotides) / 85 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_174
Orthogroup size 9
N. genomes 7

Actions

Genomic region

Domains

PF01381 Helix-turn-helix

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1396 Transcription (K) K Transcriptional regulator, contains XRE-family HTH domain

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K15773 HTH-type transcriptional regulator / antitoxin HipB - -

Protein Sequence

MIIINAYQLSVHLKDVRLTKKLSQSKVAQKVGIRQDTVSNFELNPNSTKLETFFKLLSALNLEMEIHPKDAKNNLAHKSEWKEEW

Flanking regions ( +/- flanking 50bp)

ACGCTATAACCGGTATATTAGATATTAACGCCTATAACCGGTAGAAGATGATGATCATAATTAATGCCTATCAACTCAGTGTGCATCTAAAAGATGTCCGATTAACAAAAAAACTGTCTCAAAGTAAAGTCGCCCAAAAAGTAGGGATCCGACAAGATACCGTGTCCAATTTTGAACTTAATCCTAATTCCACCAAACTAGAAACCTTTTTCAAACTGCTCTCCGCACTAAATTTAGAGATGGAAATTCATCCTAAAGATGCTAAAAATAATTTAGCACACAAAAGTGAATGGAAAGAGGAGTGGTAAATGGCGAGTCTTGATGTATATATGAATGAATACTATGTGGGCATCTTTAC