Homologs in group_3586

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_19620 FBDBKF_19620 100.0 Morganella morganii S1 hipB Transcriptional regulator, contains XRE-family HTH domain
EHELCC_16910 EHELCC_16910 100.0 Morganella morganii S2 hipB Transcriptional regulator, contains XRE-family HTH domain
NLDBIP_17540 NLDBIP_17540 100.0 Morganella morganii S4 hipB Transcriptional regulator, contains XRE-family HTH domain
LHKJJB_17460 LHKJJB_17460 100.0 Morganella morganii S3 hipB Transcriptional regulator, contains XRE-family HTH domain

Distribution of the homologs in the orthogroup group_3586

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3586

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P9WJA7 1.61e-08 52 35 0 79 1 higA1 Antitoxin HigA1 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WJA6 1.61e-08 52 35 0 79 3 higA1 Antitoxin HigA1 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P55411 0.000258 41 37 0 48 4 NGR_a04050 Uncharacterized HTH-type transcriptional regulator y4dL Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P06153 0.000578 40 33 1 62 1 None Immunity repressor protein Bacillus phage phi105
O27383 0.000659 38 40 0 49 4 MTH_1328 Uncharacterized HTH-type transcriptional regulator MTH_1328 Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q57720 0.000696 38 33 0 54 4 MJ0272 Uncharacterized HTH-type transcriptional regulator MJ0272 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_17275
Feature type CDS
Gene hipB
Product Transcriptional regulator, contains XRE-family HTH domain
Location 11171 - 11488 (strand: -1)
Length 318 (nucleotides) / 105 (amino acids)

Contig

Accession ZDB_700
Length 55765 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3586
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Domains

PF01381 Helix-turn-helix

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1396 Transcription (K) K Transcriptional regulator, contains XRE-family HTH domain

Protein Sequence

MSRNDDYDLVPFEELKNTLLKDPEVIDALDEIQARKVLLDTLKAARKARKITQAEVAEKMATQKQNISRLEKGDYDPQLGTLIRYADAIGGRLSFDFLPVISESV

Flanking regions ( +/- flanking 50bp)

GTGCTAGAGTTAGCACATGAGAGAATGAAAGAAGTGATAAGGAGGCTGAAATGAGTCGTAATGATGATTATGATTTAGTCCCTTTTGAAGAGCTGAAAAATACATTACTTAAAGATCCTGAAGTTATTGATGCACTGGATGAAATTCAGGCACGGAAAGTATTGCTGGATACATTAAAAGCAGCAAGAAAAGCCCGGAAAATTACCCAGGCTGAAGTGGCTGAAAAAATGGCAACGCAAAAACAGAATATTTCCCGCCTGGAAAAAGGGGACTATGACCCGCAACTGGGAACATTGATTCGTTATGCAGACGCCATTGGCGGACGATTATCTTTTGATTTTCTGCCTGTAATTTCGGAGTCTGTCTGATAATACCGGCGGTTACCTTGCCGTTATACAGCCAGCAAAAGCCGCCCGGC