Homologs in group_893

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04665 FBDBKF_04665 92.2 Morganella morganii S1 emrA Multidrug resistance efflux pump EmrA
EHELCC_05955 EHELCC_05955 92.2 Morganella morganii S2 emrA Multidrug resistance efflux pump EmrA
NLDBIP_06275 NLDBIP_06275 92.2 Morganella morganii S4 emrA Multidrug resistance efflux pump EmrA
LHKJJB_03155 LHKJJB_03155 92.2 Morganella morganii S3 emrA Multidrug resistance efflux pump EmrA
HKOGLL_06630 HKOGLL_06630 92.2 Morganella morganii S5 emrA Multidrug resistance efflux pump EmrA
PMI_RS05900 PMI_RS05900 73.7 Proteus mirabilis HI4320 - biotin/lipoyl-binding protein

Distribution of the homologs in the orthogroup group_893

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_893

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P37626 3.49e-147 422 62 2 359 3 yhiI Uncharacterized protein YhiI Escherichia coli (strain K12)
Q93AA7 3.13e-28 115 30 6 304 3 YP_0975 UPF0194 membrane protein YP_0975 Yersinia pestis
B1JSP3 3.13e-28 115 30 6 304 3 YPK_2900 UPF0194 membrane protein YPK_2900 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q1CFT7 3.13e-28 115 30 6 304 3 YPN_2816 UPF0194 membrane protein YPN_2816 Yersinia pestis bv. Antiqua (strain Nepal516)
A7FKJ7 3.13e-28 115 30 6 304 3 YpsIP31758_2812 UPF0194 membrane protein YpsIP31758_2812 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q1C912 3.13e-28 115 30 6 304 3 YPA_1093 UPF0194 membrane protein YPA_1093 Yersinia pestis bv. Antiqua (strain Antiqua)
B2K8W1 3.76e-28 115 30 6 304 3 YPTS_1292 UPF0194 membrane protein YPTS_1292 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q66D37 3.76e-28 115 30 6 304 3 YPTB1212 UPF0194 membrane protein YPTB1212 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4W8D7 1.73e-27 113 30 5 280 3 Ent638_1286 UPF0194 membrane protein Ent638_1286 Enterobacter sp. (strain 638)
A9MIT3 7.54e-27 111 30 6 312 3 ybhG UPF0194 membrane protein YbhG Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A1JSL8 1.33e-26 110 28 6 321 3 YE2891 UPF0194 membrane protein YE2891 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q8ZQP0 8.03e-25 106 30 4 284 3 ybhG UPF0194 membrane protein YbhG Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z879 8.03e-25 106 30 4 284 3 ybhG UPF0194 membrane protein YbhG Salmonella typhi
C0PX06 8.03e-25 106 30 4 284 3 ybhG UPF0194 membrane protein YbhG Salmonella paratyphi C (strain RKS4594)
B5QXS4 8.03e-25 106 30 4 284 3 ybhG UPF0194 membrane protein YbhG Salmonella enteritidis PT4 (strain P125109)
B5FP83 8.03e-25 106 30 4 284 3 ybhG UPF0194 membrane protein YbhG Salmonella dublin (strain CT_02021853)
Q57RE0 8.03e-25 106 30 4 284 3 ybhG UPF0194 membrane protein YbhG Salmonella choleraesuis (strain SC-B67)
B5F095 8.03e-25 106 30 4 284 3 ybhG UPF0194 membrane protein YbhG Salmonella agona (strain SL483)
B5R785 9.15e-25 106 30 4 284 3 ybhG UPF0194 membrane protein YbhG Salmonella gallinarum (strain 287/91 / NCTC 13346)
B4TQW1 1.07e-24 105 30 4 284 3 ybhG UPF0194 membrane protein YbhG Salmonella schwarzengrund (strain CVM19633)
A9MSW1 1.07e-24 105 30 4 284 3 ybhG UPF0194 membrane protein YbhG Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4T074 1.07e-24 105 30 4 284 3 ybhG UPF0194 membrane protein YbhG Salmonella newport (strain SL254)
B4TC72 1.07e-24 105 30 4 284 3 ybhG UPF0194 membrane protein YbhG Salmonella heidelberg (strain SL476)
B5BC09 1.11e-24 105 30 4 284 3 ybhG UPF0194 membrane protein YbhG Salmonella paratyphi A (strain AKU_12601)
Q5PG34 1.11e-24 105 30 4 284 3 ybhG UPF0194 membrane protein YbhG Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q9L9D4 5.59e-24 103 26 2 301 3 None UPF0194 membrane protein in asrC 5'region (Fragment) Acidithiobacillus ferridurans
A8AIZ1 6.33e-24 103 29 4 284 3 CKO_02332 UPF0194 membrane protein CKO_02332 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q0TJQ3 3e-23 102 30 4 284 3 ybhG UPF0194 membrane protein YbhG Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q8FJN6 3.51e-23 101 30 4 284 3 ybhG UPF0194 membrane protein YbhG Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A1A936 3.72e-23 101 30 4 284 3 ybhG UPF0194 membrane protein YbhG Escherichia coli O1:K1 / APEC
B7MQP9 3.72e-23 101 30 4 284 3 ybhG UPF0194 membrane protein YbhG Escherichia coli O81 (strain ED1a)
B7MGQ3 3.72e-23 101 30 4 284 3 ybhG UPF0194 membrane protein YbhG Escherichia coli O45:K1 (strain S88 / ExPEC)
Q1RED2 8.17e-23 100 30 4 284 3 ybhG UPF0194 membrane protein YbhG Escherichia coli (strain UTI89 / UPEC)
P75777 1.45e-22 100 30 4 284 2 ybhG UPF0194 membrane protein YbhG Escherichia coli (strain K12)
B1X7C5 1.45e-22 100 30 4 284 3 ybhG UPF0194 membrane protein YbhG Escherichia coli (strain K12 / DH10B)
C4ZXW7 1.45e-22 100 30 4 284 3 ybhG UPF0194 membrane protein YbhG Escherichia coli (strain K12 / MC4100 / BW2952)
A7ZJK6 1.75e-22 99 30 4 284 3 ybhG UPF0194 membrane protein YbhG Escherichia coli O139:H28 (strain E24377A / ETEC)
B6I7V1 1.81e-22 99 30 4 284 3 ybhG UPF0194 membrane protein YbhG Escherichia coli (strain SE11)
B7M768 1.81e-22 99 30 4 284 3 ybhG UPF0194 membrane protein YbhG Escherichia coli O8 (strain IAI1)
B7LC78 1.81e-22 99 30 4 284 3 ybhG UPF0194 membrane protein YbhG Escherichia coli (strain 55989 / EAEC)
B7LJW4 1.94e-22 99 30 4 284 3 ybhG UPF0194 membrane protein YbhG Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B7NA95 1.94e-22 99 30 4 284 3 ybhG UPF0194 membrane protein YbhG Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B7NNM5 1.94e-22 99 30 4 284 3 ybhG UPF0194 membrane protein YbhG Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q8X7Y9 1.94e-22 99 30 4 284 3 ybhG UPF0194 membrane protein YbhG Escherichia coli O157:H7
B7ULZ2 1.94e-22 99 30 4 284 3 ybhG UPF0194 membrane protein YbhG Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q0T6G6 1.97e-22 99 30 4 284 3 ybhG UPF0194 membrane protein YbhG Shigella flexneri serotype 5b (strain 8401)
B1LM86 1.97e-22 99 30 4 284 3 ybhG UPF0194 membrane protein YbhG Escherichia coli (strain SMS-3-5 / SECEC)
B1IXH3 1.97e-22 99 30 4 284 3 ybhG UPF0194 membrane protein YbhG Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A7ZY51 1.97e-22 99 30 4 284 3 ybhG UPF0194 membrane protein YbhG Escherichia coli O9:H4 (strain HS)
B5YS86 1.97e-22 99 30 4 284 3 ybhG UPF0194 membrane protein YbhG Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q3Z3Z0 2.32e-22 99 30 4 284 3 ybhG UPF0194 membrane protein YbhG Shigella sonnei (strain Ss046)
Q32I67 2.41e-22 99 30 4 284 3 ybhG UPF0194 membrane protein YbhG Shigella dysenteriae serotype 1 (strain Sd197)
Q323Z9 3.06e-22 99 30 4 284 3 ybhG UPF0194 membrane protein YbhG Shigella boydii serotype 4 (strain Sb227)
Q83S36 9.1e-22 97 29 4 284 3 ybhG UPF0194 membrane protein YbhG Shigella flexneri
Q9ZJD1 6.09e-18 87 28 3 234 3 jhp_1381 36 kDa antigen Helicobacter pylori (strain J99 / ATCC 700824)
Q92V44 1.14e-17 86 28 9 317 3 RB0873 UPF0194 membrane protein RB0873 Rhizobium meliloti (strain 1021)
P94851 3.74e-17 84 27 3 234 3 HP_1488 36 kDa antigen Helicobacter pylori (strain ATCC 700392 / 26695)
P0DPR6 4.14e-12 70 23 7 355 2 emrA Colistin resistance protein EmrA Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
P44928 2.09e-09 62 24 3 235 3 emrA Multidrug export protein EmrA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P76185 1.22e-08 58 24 6 245 3 ydhJ Uncharacterized protein YdhJ Escherichia coli (strain K12)
D3V7P2 1.42e-08 59 22 9 297 3 mdtA Multidrug resistance protein MdtA Xenorhabdus bovienii (strain SS-2004)
C6DBC6 1.87e-08 59 26 3 192 3 mdtA Multidrug resistance protein MdtA Pectobacterium carotovorum subsp. carotovorum (strain PC1)
P64177 2.25e-08 58 25 11 275 3 macA Macrolide export protein MacA Shigella flexneri
P64176 2.25e-08 58 25 11 275 3 macA Macrolide export protein MacA Escherichia coli O157:H7
B4EY99 6.97e-08 57 25 6 231 3 mdtA Multidrug resistance protein MdtA Proteus mirabilis (strain HI4320)
Q6D2B2 8.42e-08 57 26 4 192 3 mdtA Multidrug resistance protein MdtA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P75830 9.68e-08 57 25 11 275 1 macA Macrolide export protein MacA Escherichia coli (strain K12)
B1JSD5 1.69e-07 56 25 4 215 3 mdtA Multidrug resistance protein MdtA Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A4TMR2 1.72e-07 56 25 4 215 3 mdtA Multidrug resistance protein MdtA Yersinia pestis (strain Pestoides F)
Q1CK59 1.72e-07 56 25 4 215 3 mdtA Multidrug resistance protein MdtA Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZCW1 1.72e-07 56 25 4 215 3 mdtA Multidrug resistance protein MdtA Yersinia pestis
Q1C5M1 1.72e-07 56 25 4 215 3 mdtA Multidrug resistance protein MdtA Yersinia pestis bv. Antiqua (strain Antiqua)
A7FG18 1.74e-07 56 25 4 215 3 mdtA Multidrug resistance protein MdtA Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q83P86 1.77e-07 55 22 4 235 3 mdtN Multidrug resistance protein MdtN Shigella flexneri
P52599 1.78e-07 56 24 8 277 2 emrK Probable multidrug resistance protein EmrK Escherichia coli (strain K12)
P32716 1.78e-07 55 23 4 235 2 mdtN Multidrug resistance protein MdtN Escherichia coli (strain K12)
Q668C7 1.8e-07 56 25 4 215 3 mdtA Multidrug resistance protein MdtA Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K9L9 1.8e-07 56 25 4 215 3 mdtA Multidrug resistance protein MdtA Yersinia pseudotuberculosis serotype IB (strain PB1/+)
P58411 1.83e-07 55 25 12 284 3 macA Macrolide export protein MacA Yersinia pestis
Q8X5R2 1.97e-07 55 22 4 235 3 mdtN Multidrug resistance protein MdtN Escherichia coli O157:H7
Q8FAX1 2.25e-07 55 22 4 235 3 mdtN Multidrug resistance protein MdtN Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7NCB0 3.49e-07 55 25 4 213 3 mdtA Multidrug resistance protein MdtA Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
A4WCC0 3.55e-07 55 25 4 213 3 mdtA Multidrug resistance protein MdtA Enterobacter sp. (strain 638)
B7NQB2 3.85e-07 55 25 4 213 3 mdtA Multidrug resistance protein MdtA Escherichia coli O7:K1 (strain IAI39 / ExPEC)
C9XVZ5 5.17e-07 54 23 7 288 3 mdtA Multidrug resistance protein MdtA Cronobacter turicensis (strain DSM 18703 / CCUG 55852 / LMG 23827 / z3032)
B2TYA9 7.32e-07 54 24 4 213 3 mdtA Multidrug resistance protein MdtA Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B5YUD2 7.32e-07 54 24 4 213 3 mdtA Multidrug resistance protein MdtA Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X7J5 7.32e-07 54 24 4 213 3 mdtA Multidrug resistance protein MdtA Escherichia coli O157:H7
A6TBH3 8.47e-07 53 24 3 213 3 mdtA Multidrug resistance protein MdtA Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B7MWY7 1.13e-06 53 24 4 213 3 mdtA Multidrug resistance protein MdtA Escherichia coli O81 (strain ED1a)
Q0TG16 1.15e-06 53 24 4 213 3 mdtA Multidrug resistance protein MdtA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A7ZNP7 1.17e-06 53 24 4 213 3 mdtA Multidrug resistance protein MdtA Escherichia coli O139:H28 (strain E24377A / ETEC)
B7M457 1.22e-06 53 24 4 213 3 mdtA Multidrug resistance protein MdtA Escherichia coli O8 (strain IAI1)
Q8CVX8 1.24e-06 53 24 4 213 3 mdtA Multidrug resistance protein MdtA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7L9U7 1.25e-06 53 24 4 215 3 mdtA Multidrug resistance protein MdtA Escherichia coli (strain 55989 / EAEC)
P76397 1.38e-06 53 24 4 213 2 mdtA Multidrug resistance protein MdtA Escherichia coli (strain K12)
A8A1U6 1.38e-06 53 24 4 213 3 mdtA Multidrug resistance protein MdtA Escherichia coli O9:H4 (strain HS)
B1X7H0 1.38e-06 53 24 4 213 3 mdtA Multidrug resistance protein MdtA Escherichia coli (strain K12 / DH10B)
C4ZSG2 1.38e-06 53 24 4 213 3 mdtA Multidrug resistance protein MdtA Escherichia coli (strain K12 / MC4100 / BW2952)
B7UTB2 1.38e-06 53 24 4 213 3 mdtA Multidrug resistance protein MdtA Escherichia coli O127:H6 (strain E2348/69 / EPEC)
D2BTK6 1.47e-06 53 23 2 230 3 mdtA Multidrug resistance protein MdtA Dickeya zeae (strain Ech586)
B7ME86 2.33e-06 52 24 4 213 3 mdtA Multidrug resistance protein MdtA Escherichia coli O45:K1 (strain S88 / ExPEC)
B1LNW7 2.69e-06 52 24 4 213 3 mdtA Multidrug resistance protein MdtA Escherichia coli (strain SMS-3-5 / SECEC)
A1JKX1 3.34e-06 52 24 4 215 3 mdtA Multidrug resistance protein MdtA Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B7LV38 3.39e-06 52 24 4 213 3 mdtA Multidrug resistance protein MdtA Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q9RQ30 4.99e-06 51 26 3 250 1 farA Fatty acid resistance protein FarA Neisseria gonorrhoeae
Q83KI5 5.17e-06 51 24 4 213 3 mdtA Putative multidrug resistance protein MdtA Shigella flexneri
B4T9U0 9.16e-06 50 26 1 138 3 mdtA Multidrug resistance protein MdtA Salmonella heidelberg (strain SL476)
Q8Z5F8 9.92e-06 50 26 1 138 3 mdtA Multidrug resistance protein MdtA Salmonella typhi
C0Q1F4 9.92e-06 50 26 1 138 3 mdtA Multidrug resistance protein MdtA Salmonella paratyphi C (strain RKS4594)
Q8ZNQ3 1.11e-05 50 26 1 138 3 mdtA Multidrug resistance protein MdtA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P43505 9.7e-05 47 31 2 138 3 mtrC Membrane fusion protein MtrC Neisseria gonorrhoeae
C5BHN6 0.000897 44 25 7 214 3 mdtA Multidrug resistance protein MdtA Edwardsiella ictaluri (strain 93-146)
F2EYD8 0.001 44 27 1 133 3 mdtA Multidrug resistance protein MdtA Pantoea ananatis (strain AJ13355)
P27303 0.001 44 22 4 277 1 emrA Multidrug export protein EmrA Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS09130
Feature type CDS
Gene -
Product HlyD family efflux transporter periplasmic adaptor subunit
Location 1910350 - 1911423 (strand: 1)
Length 1074 (nucleotides) / 357 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_893
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF13437 HlyD family secretion protein
PF13533 Biotin-lipoyl like

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1566 Defense mechanisms (V) V Multidrug resistance efflux pump EmrA

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K01993 HlyD family secretion protein - -

Protein Sequence

MQKSKRKTWIFYLLLVVVLIAGGYLYRLMSSPGLPAGFAQSNGRIEATEIDISTKTAGRISTINVREGDFVRAGDVLAQMDTRTLEAQLSEAQAQYRQATSNVVSSRSALAQRKSEKTAAEAMVRQRQSELNAAQKRLARSQALVKTNAISVQQLDDDLAVVQGAHAAVEAAKAQVAAASAAIDAAQSGIIQAQTRVDAALATQQRIEADLDDSQLKAPRNGRVQYRVAEPGEVLGAGGRVVNMVDLSDVYMTFFLPTEQAGQAGIGSEVHIILDAAPNLVIPAKTSYVASVAQFTPKTVETDNERQKLMFRVRARIAPELLEKNLEYVKTGLPGRAYIRLDPKQEWPAELEVKLPQ

Flanking regions ( +/- flanking 50bp)

CCGTTGTGTTTATCTCATTATTATTCACAAGAAGAGTAATCACGGTGTCTATGCAAAAATCAAAACGTAAAACGTGGATCTTTTACCTCCTGCTGGTTGTTGTTCTCATTGCCGGGGGCTATCTGTACCGGTTGATGAGCAGCCCCGGGCTGCCTGCCGGATTTGCGCAAAGCAACGGCCGGATAGAAGCAACGGAAATTGATATTTCGACTAAAACTGCCGGACGTATCAGTACCATCAATGTCAGAGAAGGTGATTTTGTCCGTGCCGGTGATGTTCTGGCGCAGATGGATACCCGCACACTTGAGGCACAACTGAGTGAAGCGCAGGCGCAATATCGCCAGGCTACCAGCAATGTGGTTTCCTCCCGTTCGGCGCTCGCTCAGCGGAAAAGTGAAAAAACCGCCGCAGAAGCCATGGTACGCCAGCGCCAGTCTGAGCTGAATGCCGCGCAAAAACGTCTCGCCCGCTCTCAGGCACTGGTAAAAACCAATGCCATCTCCGTTCAGCAGCTTGATGATGACCTTGCGGTGGTTCAGGGCGCACACGCGGCTGTCGAAGCCGCCAAAGCCCAGGTTGCAGCCGCCTCAGCGGCAATTGATGCCGCGCAGTCCGGCATTATTCAGGCGCAGACCCGGGTTGATGCCGCACTCGCCACACAACAGCGTATTGAGGCCGATCTCGATGACAGTCAGCTGAAAGCCCCGCGCAACGGTCGTGTGCAATACCGTGTTGCAGAACCGGGCGAAGTGCTGGGTGCCGGTGGTCGTGTCGTGAATATGGTCGATCTCAGTGATGTGTATATGACTTTTTTCCTGCCGACAGAACAGGCGGGACAAGCCGGTATCGGCAGCGAAGTTCATATTATCCTCGATGCCGCGCCAAATCTGGTGATACCGGCGAAAACCTCGTATGTCGCCAGTGTTGCACAATTTACCCCGAAAACAGTGGAAACAGATAACGAGCGGCAGAAACTGATGTTTCGTGTCCGTGCGCGGATAGCCCCTGAATTACTGGAAAAAAATCTGGAATATGTGAAAACAGGTCTGCCGGGACGCGCATACATTCGTTTGGATCCCAAACAGGAATGGCCTGCTGAACTGGAGGTGAAATTACCTCAATGACATCATCACAGAAGCTTTCCGCCACCGCGATCGTCACACTTGAACAGGTT