Homologs in group_893

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04665 FBDBKF_04665 100.0 Morganella morganii S1 emrA Multidrug resistance efflux pump EmrA
EHELCC_05955 EHELCC_05955 100.0 Morganella morganii S2 emrA Multidrug resistance efflux pump EmrA
NLDBIP_06275 NLDBIP_06275 100.0 Morganella morganii S4 emrA Multidrug resistance efflux pump EmrA
HKOGLL_06630 HKOGLL_06630 100.0 Morganella morganii S5 emrA Multidrug resistance efflux pump EmrA
F4V73_RS09130 F4V73_RS09130 92.2 Morganella psychrotolerans - HlyD family efflux transporter periplasmic adaptor subunit
PMI_RS05900 PMI_RS05900 74.2 Proteus mirabilis HI4320 - biotin/lipoyl-binding protein

Distribution of the homologs in the orthogroup group_893

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_893

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P37626 3.04e-145 417 61 2 359 3 yhiI Uncharacterized protein YhiI Escherichia coli (strain K12)
B2K8W1 5.26e-29 117 30 7 321 3 YPTS_1292 UPF0194 membrane protein YPTS_1292 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q66D37 5.26e-29 117 30 7 321 3 YPTB1212 UPF0194 membrane protein YPTB1212 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4W8D7 1.51e-28 116 29 5 301 3 Ent638_1286 UPF0194 membrane protein Ent638_1286 Enterobacter sp. (strain 638)
A9MIT3 1.6e-28 116 29 5 307 3 ybhG UPF0194 membrane protein YbhG Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q93AA7 3.23e-28 115 29 7 321 3 YP_0975 UPF0194 membrane protein YP_0975 Yersinia pestis
B1JSP3 3.23e-28 115 29 7 321 3 YPK_2900 UPF0194 membrane protein YPK_2900 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q1CFT7 3.23e-28 115 29 7 321 3 YPN_2816 UPF0194 membrane protein YPN_2816 Yersinia pestis bv. Antiqua (strain Nepal516)
A7FKJ7 3.23e-28 115 29 7 321 3 YpsIP31758_2812 UPF0194 membrane protein YpsIP31758_2812 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q1C912 3.23e-28 115 29 7 321 3 YPA_1093 UPF0194 membrane protein YPA_1093 Yersinia pestis bv. Antiqua (strain Antiqua)
A1JSL8 1.22e-27 114 28 6 320 3 YE2891 UPF0194 membrane protein YE2891 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q8ZQP0 3.22e-27 112 30 5 301 3 ybhG UPF0194 membrane protein YbhG Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z879 3.22e-27 112 30 5 301 3 ybhG UPF0194 membrane protein YbhG Salmonella typhi
C0PX06 3.22e-27 112 30 5 301 3 ybhG UPF0194 membrane protein YbhG Salmonella paratyphi C (strain RKS4594)
B5QXS4 3.22e-27 112 30 5 301 3 ybhG UPF0194 membrane protein YbhG Salmonella enteritidis PT4 (strain P125109)
B5FP83 3.22e-27 112 30 5 301 3 ybhG UPF0194 membrane protein YbhG Salmonella dublin (strain CT_02021853)
Q57RE0 3.22e-27 112 30 5 301 3 ybhG UPF0194 membrane protein YbhG Salmonella choleraesuis (strain SC-B67)
B5F095 3.22e-27 112 30 5 301 3 ybhG UPF0194 membrane protein YbhG Salmonella agona (strain SL483)
B5R785 3.67e-27 112 30 5 301 3 ybhG UPF0194 membrane protein YbhG Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5BC09 4.36e-27 112 30 5 301 3 ybhG UPF0194 membrane protein YbhG Salmonella paratyphi A (strain AKU_12601)
Q5PG34 4.36e-27 112 30 5 301 3 ybhG UPF0194 membrane protein YbhG Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4TQW1 4.41e-27 112 30 5 301 3 ybhG UPF0194 membrane protein YbhG Salmonella schwarzengrund (strain CVM19633)
A9MSW1 4.41e-27 112 30 5 301 3 ybhG UPF0194 membrane protein YbhG Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4T074 4.41e-27 112 30 5 301 3 ybhG UPF0194 membrane protein YbhG Salmonella newport (strain SL254)
B4TC72 4.41e-27 112 30 5 301 3 ybhG UPF0194 membrane protein YbhG Salmonella heidelberg (strain SL476)
A8AIZ1 3.86e-25 107 29 5 301 3 CKO_02332 UPF0194 membrane protein CKO_02332 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q3Z3Z0 1.35e-23 102 29 5 301 3 ybhG UPF0194 membrane protein YbhG Shigella sonnei (strain Ss046)
P75777 1.13e-22 100 30 4 279 2 ybhG UPF0194 membrane protein YbhG Escherichia coli (strain K12)
B1X7C5 1.13e-22 100 30 4 279 3 ybhG UPF0194 membrane protein YbhG Escherichia coli (strain K12 / DH10B)
C4ZXW7 1.13e-22 100 30 4 279 3 ybhG UPF0194 membrane protein YbhG Escherichia coli (strain K12 / MC4100 / BW2952)
B6I7V1 1.57e-22 99 30 4 279 3 ybhG UPF0194 membrane protein YbhG Escherichia coli (strain SE11)
B7M768 1.57e-22 99 30 4 279 3 ybhG UPF0194 membrane protein YbhG Escherichia coli O8 (strain IAI1)
B7LC78 1.57e-22 99 30 4 279 3 ybhG UPF0194 membrane protein YbhG Escherichia coli (strain 55989 / EAEC)
B7LJW4 1.7e-22 99 30 4 279 3 ybhG UPF0194 membrane protein YbhG Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B7NA95 1.7e-22 99 30 4 279 3 ybhG UPF0194 membrane protein YbhG Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B7NNM5 1.7e-22 99 30 4 279 3 ybhG UPF0194 membrane protein YbhG Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q8X7Y9 1.7e-22 99 30 4 279 3 ybhG UPF0194 membrane protein YbhG Escherichia coli O157:H7
B7ULZ2 1.7e-22 99 30 4 279 3 ybhG UPF0194 membrane protein YbhG Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZJK6 1.89e-22 99 30 4 279 3 ybhG UPF0194 membrane protein YbhG Escherichia coli O139:H28 (strain E24377A / ETEC)
Q32I67 2.06e-22 99 30 4 279 3 ybhG UPF0194 membrane protein YbhG Shigella dysenteriae serotype 1 (strain Sd197)
Q0T6G6 2.09e-22 99 30 4 279 3 ybhG UPF0194 membrane protein YbhG Shigella flexneri serotype 5b (strain 8401)
B1LM86 2.09e-22 99 30 4 279 3 ybhG UPF0194 membrane protein YbhG Escherichia coli (strain SMS-3-5 / SECEC)
B1IXH3 2.09e-22 99 30 4 279 3 ybhG UPF0194 membrane protein YbhG Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A7ZY51 2.09e-22 99 30 4 279 3 ybhG UPF0194 membrane protein YbhG Escherichia coli O9:H4 (strain HS)
B5YS86 2.09e-22 99 30 4 279 3 ybhG UPF0194 membrane protein YbhG Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q323Z9 3.06e-22 99 29 5 303 3 ybhG UPF0194 membrane protein YbhG Shigella boydii serotype 4 (strain Sb227)
Q9L9D4 4.75e-22 98 26 2 301 3 None UPF0194 membrane protein in asrC 5'region (Fragment) Acidithiobacillus ferridurans
Q8FJN6 6.19e-22 98 29 4 279 3 ybhG UPF0194 membrane protein YbhG Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TJQ3 6.47e-22 98 29 4 279 3 ybhG UPF0194 membrane protein YbhG Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1A936 6.63e-22 98 29 4 279 3 ybhG UPF0194 membrane protein YbhG Escherichia coli O1:K1 / APEC
B7MQP9 6.63e-22 98 29 4 279 3 ybhG UPF0194 membrane protein YbhG Escherichia coli O81 (strain ED1a)
B7MGQ3 6.63e-22 98 29 4 279 3 ybhG UPF0194 membrane protein YbhG Escherichia coli O45:K1 (strain S88 / ExPEC)
Q83S36 7.92e-22 97 29 4 279 3 ybhG UPF0194 membrane protein YbhG Shigella flexneri
Q1RED2 1.26e-21 97 29 4 279 3 ybhG UPF0194 membrane protein YbhG Escherichia coli (strain UTI89 / UPEC)
Q92V44 2.22e-18 88 28 7 322 3 RB0873 UPF0194 membrane protein RB0873 Rhizobium meliloti (strain 1021)
P94851 1.89e-16 82 27 3 234 3 HP_1488 36 kDa antigen Helicobacter pylori (strain ATCC 700392 / 26695)
Q9ZJD1 3.01e-15 79 27 3 234 3 jhp_1381 36 kDa antigen Helicobacter pylori (strain J99 / ATCC 700824)
P0DPR6 4.53e-13 72 24 8 354 2 emrA Colistin resistance protein EmrA Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
Q8FAX1 5.66e-09 60 25 2 207 3 mdtN Multidrug resistance protein MdtN Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P64177 7.42e-09 60 25 10 285 3 macA Macrolide export protein MacA Shigella flexneri
P64176 7.42e-09 60 25 10 285 3 macA Macrolide export protein MacA Escherichia coli O157:H7
P44928 1.3e-08 59 23 3 235 3 emrA Multidrug export protein EmrA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8X5R2 2.29e-08 58 23 2 213 3 mdtN Multidrug resistance protein MdtN Escherichia coli O157:H7
P75830 2.53e-08 58 25 10 285 1 macA Macrolide export protein MacA Escherichia coli (strain K12)
Q83P86 2.87e-08 58 24 2 207 3 mdtN Multidrug resistance protein MdtN Shigella flexneri
P32716 3.03e-08 58 25 2 207 2 mdtN Multidrug resistance protein MdtN Escherichia coli (strain K12)
P76185 7.8e-08 56 23 6 242 3 ydhJ Uncharacterized protein YdhJ Escherichia coli (strain K12)
D3V7P2 3.15e-07 55 22 9 293 3 mdtA Multidrug resistance protein MdtA Xenorhabdus bovienii (strain SS-2004)
C6DBC6 4.34e-07 55 24 3 209 3 mdtA Multidrug resistance protein MdtA Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D2B2 7.39e-07 54 22 2 211 3 mdtA Multidrug resistance protein MdtA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A4WCC0 1.34e-06 53 24 4 213 3 mdtA Multidrug resistance protein MdtA Enterobacter sp. (strain 638)
B4EY99 1.46e-06 53 25 7 231 3 mdtA Multidrug resistance protein MdtA Proteus mirabilis (strain HI4320)
B2TYA9 1.8e-06 53 24 4 213 3 mdtA Multidrug resistance protein MdtA Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B5YUD2 1.8e-06 53 24 4 213 3 mdtA Multidrug resistance protein MdtA Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X7J5 1.8e-06 53 24 4 213 3 mdtA Multidrug resistance protein MdtA Escherichia coli O157:H7
B7NCB0 2.55e-06 52 24 4 213 3 mdtA Multidrug resistance protein MdtA Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B7NQB2 2.76e-06 52 24 4 213 3 mdtA Multidrug resistance protein MdtA Escherichia coli O7:K1 (strain IAI39 / ExPEC)
P58411 3.79e-06 52 25 13 284 3 macA Macrolide export protein MacA Yersinia pestis
B7ME86 3.91e-06 52 24 4 213 3 mdtA Multidrug resistance protein MdtA Escherichia coli O45:K1 (strain S88 / ExPEC)
B7M457 6.79e-06 51 24 4 213 3 mdtA Multidrug resistance protein MdtA Escherichia coli O8 (strain IAI1)
D2BTK6 6.8e-06 51 23 4 230 3 mdtA Multidrug resistance protein MdtA Dickeya zeae (strain Ech586)
B7MWY7 7.04e-06 51 24 4 213 3 mdtA Multidrug resistance protein MdtA Escherichia coli O81 (strain ED1a)
C9XVZ5 7.04e-06 51 22 7 288 3 mdtA Multidrug resistance protein MdtA Cronobacter turicensis (strain DSM 18703 / CCUG 55852 / LMG 23827 / z3032)
Q8CVX8 7.42e-06 51 24 4 213 3 mdtA Multidrug resistance protein MdtA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TG16 7.42e-06 51 24 4 213 3 mdtA Multidrug resistance protein MdtA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q9RQ30 8.15e-06 50 27 5 253 1 farA Fatty acid resistance protein FarA Neisseria gonorrhoeae
A7ZNP7 8.26e-06 50 24 4 213 3 mdtA Multidrug resistance protein MdtA Escherichia coli O139:H28 (strain E24377A / ETEC)
B7L9U7 8.71e-06 50 24 4 215 3 mdtA Multidrug resistance protein MdtA Escherichia coli (strain 55989 / EAEC)
P76397 9.78e-06 50 24 4 213 2 mdtA Multidrug resistance protein MdtA Escherichia coli (strain K12)
A8A1U6 9.78e-06 50 24 4 213 3 mdtA Multidrug resistance protein MdtA Escherichia coli O9:H4 (strain HS)
B1X7H0 9.78e-06 50 24 4 213 3 mdtA Multidrug resistance protein MdtA Escherichia coli (strain K12 / DH10B)
C4ZSG2 9.78e-06 50 24 4 213 3 mdtA Multidrug resistance protein MdtA Escherichia coli (strain K12 / MC4100 / BW2952)
B7UTB2 9.78e-06 50 24 4 213 3 mdtA Multidrug resistance protein MdtA Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B1LNW7 1.85e-05 50 24 4 213 3 mdtA Multidrug resistance protein MdtA Escherichia coli (strain SMS-3-5 / SECEC)
A6TBH3 1.89e-05 50 24 4 213 3 mdtA Multidrug resistance protein MdtA Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B7LV38 2.27e-05 49 24 4 213 3 mdtA Multidrug resistance protein MdtA Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q83KI5 2.94e-05 49 23 4 213 3 mdtA Putative multidrug resistance protein MdtA Shigella flexneri
A4TMR2 3.74e-05 48 24 5 215 3 mdtA Multidrug resistance protein MdtA Yersinia pestis (strain Pestoides F)
Q1CK59 3.74e-05 48 24 5 215 3 mdtA Multidrug resistance protein MdtA Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZCW1 3.74e-05 48 24 5 215 3 mdtA Multidrug resistance protein MdtA Yersinia pestis
Q1C5M1 3.74e-05 48 24 5 215 3 mdtA Multidrug resistance protein MdtA Yersinia pestis bv. Antiqua (strain Antiqua)
A7FG18 4.01e-05 48 24 5 215 3 mdtA Multidrug resistance protein MdtA Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q668C7 4.05e-05 48 24 5 215 3 mdtA Multidrug resistance protein MdtA Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K9L9 4.05e-05 48 24 5 215 3 mdtA Multidrug resistance protein MdtA Yersinia pseudotuberculosis serotype IB (strain PB1/+)
B1JSD5 4.12e-05 48 24 5 215 3 mdtA Multidrug resistance protein MdtA Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
P27303 4.43e-05 48 22 5 271 1 emrA Multidrug export protein EmrA Escherichia coli (strain K12)
Q8Z5F8 4.49e-05 48 26 1 138 3 mdtA Multidrug resistance protein MdtA Salmonella typhi
C0Q1F4 4.49e-05 48 26 1 138 3 mdtA Multidrug resistance protein MdtA Salmonella paratyphi C (strain RKS4594)
B4T9U0 4.57e-05 48 26 1 138 3 mdtA Multidrug resistance protein MdtA Salmonella heidelberg (strain SL476)
Q8ZNQ3 5.27e-05 48 26 1 138 3 mdtA Multidrug resistance protein MdtA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P52599 0.000302 46 21 7 275 2 emrK Probable multidrug resistance protein EmrK Escherichia coli (strain K12)
Q7N3E3 0.000304 46 24 7 220 3 mdtA Multidrug resistance protein MdtA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A1JKX1 0.00078 45 23 5 215 3 mdtA Multidrug resistance protein MdtA Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
P43505 0.000804 44 31 5 161 3 mtrC Membrane fusion protein MtrC Neisseria gonorrhoeae

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_03155
Feature type CDS
Gene emrA
Product Multidrug resistance efflux pump EmrA
Location 210715 - 211788 (strand: 1)
Length 1074 (nucleotides) / 357 (amino acids)

Contig

Accession ZDB_360
Length 302856 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_893
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF13437 HlyD family secretion protein
PF13533 Biotin-lipoyl like

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1566 Defense mechanisms (V) V Multidrug resistance efflux pump EmrA

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K01993 HlyD family secretion protein - -

Protein Sequence

MQKSKRKTWIFYLILIIVLAGGGYLYHMLQSPGLPAGFAQSNGRIEATEIDISTKTAGRISTINVREGDFVRAGDVLAQMDTRTLEAQLSEAQAQYRQADSNVISSRSALAQRKSEKAAAEAMVRQRTAELTAAQKRLTRSQALVRTNAVSVQQVDDDLAVVQGARAAVEAAKAQVAAASAAIDAAQSGIIQAQTKVDAALATQHRIEADLDDSQLKAPRNGRVQYRVAEPGEVLGAGGRVVNMVDLSDVYMTFFLPTEQAGQAGIGSDVHIVLDAAPDLVIPAKTSYVASVAQFTPKTVETDNERQKLMFRVRARIAPELLEKHLEYVKTGLPGRAYIRLDPKQDWPADLEVKLPQ

Flanking regions ( +/- flanking 50bp)

CTGTTGTGCTTATCTCATTATTTTCCATAAGAAGGGTAATCACGGTATCTATGCAAAAATCAAAACGTAAAACGTGGATTTTTTATCTCATCCTGATCATTGTCCTTGCCGGCGGCGGCTATCTGTACCACATGCTGCAAAGCCCGGGGCTGCCTGCAGGCTTCGCTCAGAGCAACGGACGGATCGAGGCAACGGAAATTGATATCTCAACCAAAACCGCCGGACGCATCAGCACCATCAATGTCAGAGAGGGGGATTTTGTCCGCGCCGGGGATGTGCTGGCGCAGATGGATACCCGGACTCTCGAGGCGCAGCTGAGCGAGGCTCAGGCGCAGTACCGCCAGGCAGACAGTAATGTGATTTCCTCGCGCTCGGCACTGGCTCAGCGGAAAAGTGAGAAAGCCGCCGCAGAGGCAATGGTACGTCAACGCACTGCAGAACTGACCGCTGCGCAGAAGCGTCTGACGCGTTCACAGGCACTGGTGAGAACCAACGCGGTATCTGTTCAGCAGGTGGATGATGACCTTGCTGTTGTGCAGGGTGCCCGTGCTGCTGTGGAAGCGGCGAAAGCTCAGGTGGCAGCGGCTTCTGCGGCGATTGATGCCGCACAGTCCGGTATTATCCAGGCACAGACCAAAGTGGATGCCGCTCTGGCGACACAACACCGGATTGAAGCGGATCTGGATGACAGCCAGCTGAAAGCGCCGCGCAACGGCCGTGTTCAGTATCGCGTTGCCGAACCGGGTGAAGTGCTCGGTGCCGGTGGCCGTGTGGTGAATATGGTCGATCTCAGCGATGTCTATATGACGTTCTTCCTGCCGACCGAACAGGCCGGACAGGCGGGCATCGGCAGTGATGTGCATATTGTTCTTGATGCCGCTCCGGACCTGGTGATCCCGGCGAAAACCTCGTATGTCGCCAGTGTCGCGCAGTTTACCCCTAAAACTGTGGAAACAGATAATGAGCGCCAGAAACTGATGTTCCGCGTTCGTGCGCGTATCGCCCCCGAACTGCTGGAAAAACATCTGGAATATGTGAAAACCGGTCTGCCGGGACGCGCTTATATCCGGCTTGACCCGAAGCAGGACTGGCCGGCTGACCTGGAGGTGAAATTACCTCAATGACATCATCAAAACAGCATTCCGACACCGCAATCGTCACCCTGGAACAGGTT