Homologs in group_110

Help

10 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00360 FBDBKF_00360 59.3 Morganella morganii S1 - Integrase
FBDBKF_11145 FBDBKF_11145 63.9 Morganella morganii S1 xerD Site-specific recombinase XerD
EHELCC_01185 EHELCC_01185 59.3 Morganella morganii S2 - Integrase
EHELCC_05080 EHELCC_05080 63.9 Morganella morganii S2 xerD Site-specific recombinase XerD
NLDBIP_02275 NLDBIP_02275 59.3 Morganella morganii S4 - Integrase
NLDBIP_05400 NLDBIP_05400 63.9 Morganella morganii S4 xerD Site-specific recombinase XerD
LHKJJB_02280 LHKJJB_02280 63.9 Morganella morganii S3 xerD Site-specific recombinase XerD
LHKJJB_03790 LHKJJB_03790 59.3 Morganella morganii S3 - Integrase
HKOGLL_03255 HKOGLL_03255 59.3 Morganella morganii S5 - Integrase
HKOGLL_15660 HKOGLL_15660 63.9 Morganella morganii S5 xerD Site-specific recombinase XerD

Distribution of the homologs in the orthogroup group_110

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_110

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P04890 0.0 564 71 3 378 3 int Integrase Salmonella phage P22
P24218 0.0 545 68 3 381 3 intD Prophage integrase IntD Escherichia coli (strain K12)
P16470 8.54e-13 72 29 6 224 3 rci Shufflon-specific DNA recombinase Escherichia coli
P10487 8.85e-13 72 29 6 224 3 rci Shufflon-specific DNA recombinase Escherichia coli
Q1RHT1 1.47e-12 71 27 10 262 3 xerD Tyrosine recombinase XerD Rickettsia bellii (strain RML369-C)
P21442 3.45e-12 70 29 8 243 1 int Integrase Haemophilus phage HP1 (strain HP1c1)
P06723 1.51e-11 68 29 8 244 3 int Integrase Escherichia phage 186
Q92IC9 1.16e-08 59 25 8 256 3 xerD Tyrosine recombinase XerD Rickettsia conorii (strain ATCC VR-613 / Malish 7)
A8FD78 1.77e-08 58 25 10 252 3 xerC Tyrosine recombinase XerC Bacillus pumilus (strain SAFR-032)
Q65JN5 2.56e-08 58 26 12 249 3 xerC Tyrosine recombinase XerC Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q7ZAM5 2.82e-08 58 21 8 247 3 xerC Tyrosine recombinase XerC Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q9ZDG8 9.71e-08 56 25 7 236 3 xerD Tyrosine recombinase XerD Rickettsia prowazekii (strain Madrid E)
Q8TZV9 1.09e-07 56 23 6 208 3 xerA Tyrosine recombinase XerA Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
C1DJ58 2.09e-07 55 24 8 252 3 xerC Tyrosine recombinase XerC Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q4UM01 2.14e-07 55 24 8 256 3 xerD Tyrosine recombinase XerD Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
P76056 3.03e-07 55 25 7 233 3 intR Prophage integrase IntR Escherichia coli (strain K12)
Q8R890 3.19e-07 55 22 6 205 3 TTE2127 Tyrosine recombinase XerC-like Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q8P550 5.51e-07 54 23 7 253 3 xerC Tyrosine recombinase XerC Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RNK3 5.51e-07 54 23 7 253 3 xerC Tyrosine recombinase XerC Xanthomonas campestris pv. campestris (strain B100)
Q4UYY0 5.51e-07 54 23 7 253 3 xerC Tyrosine recombinase XerC Xanthomonas campestris pv. campestris (strain 8004)
Q38067 6.66e-07 54 25 8 237 3 None Putative integrase Pseudomonas phage Pf1
Q7ZAP1 1.06e-06 53 24 5 203 3 xerD Tyrosine recombinase XerD Bifidobacterium longum (strain NCC 2705)
Q980D9 1.06e-06 53 23 6 213 1 xerA Tyrosine recombinase XerA Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
A5WAU7 1.2e-06 53 25 8 226 3 xerC Tyrosine recombinase XerC Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q88CF1 1.41e-06 53 25 8 226 3 xerC Tyrosine recombinase XerC Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q9V1P5 1.51e-06 52 21 8 253 1 xerA Tyrosine recombinase XerA Pyrococcus abyssi (strain GE5 / Orsay)
Q8NNZ9 2.15e-06 52 25 4 163 3 xerC Tyrosine recombinase XerC Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
B0KQ43 2.63e-06 52 24 8 226 3 xerC Tyrosine recombinase XerC Pseudomonas putida (strain GB-1)
B7IFN3 3.11e-06 52 27 5 156 3 THA_404 Tyrosine recombinase THA_404 Thermosipho africanus (strain TCF52B)
A7NFG3 3.56e-06 52 25 9 219 3 xerC Tyrosine recombinase XerC Roseiflexus castenholzii (strain DSM 13941 / HLO8)
Q8PPP9 4.06e-06 51 23 7 260 3 xerC Tyrosine recombinase XerC Xanthomonas axonopodis pv. citri (strain 306)
Q48733 6.25e-06 51 23 5 171 3 xerC Tyrosine recombinase XerC Lactobacillus leichmannii
Q5JHA3 6.33e-06 50 23 6 229 3 xerA Tyrosine recombinase XerA Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q51566 1.24e-05 50 26 6 225 3 xerC Tyrosine recombinase XerC Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P22877 1.31e-05 50 35 0 70 3 int Integrase Saccharopolyspora erythraea
B1J1V8 1.37e-05 50 24 6 226 3 xerC Tyrosine recombinase XerC Pseudomonas putida (strain W619)
Q04A03 1.56e-05 49 23 4 171 3 xerC Tyrosine recombinase XerC Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1G9V2 1.56e-05 49 23 4 171 3 xerC Tyrosine recombinase XerC Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
C4ZGY6 2.26e-05 49 25 4 156 3 EUBREC_2677 Tyrosine recombinase EUBREC_2677 Agathobacter rectalis (strain ATCC 33656 / DSM 3377 / JCM 17463 / KCTC 5835 / VPI 0990)
Q49XU5 2.58e-05 49 21 6 230 3 xerD Tyrosine recombinase XerD Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P76168 2.96e-05 49 22 6 224 1 intQ Putative defective protein IntQ Escherichia coli (strain K12)
Q1I301 3.06e-05 48 24 7 226 3 xerC Tyrosine recombinase XerC Pseudomonas entomophila (strain L48)
Q02E82 3.5e-05 48 26 6 225 3 xerC Tyrosine recombinase XerC Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V5H1 3.5e-05 48 26 6 225 3 xerC Tyrosine recombinase XerC Pseudomonas aeruginosa (strain LESB58)
A6VE54 4.08e-05 48 27 7 223 3 xerC Tyrosine recombinase XerC Pseudomonas aeruginosa (strain PA7)
Q0VM16 4.37e-05 48 22 6 227 3 xerC Tyrosine recombinase XerC Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q7ZAJ4 4.74e-05 48 25 6 161 3 xerC Tyrosine recombinase XerC Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HPU0 4.74e-05 48 25 6 161 3 xerC Tyrosine recombinase XerC Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
B5YFZ8 4.84e-05 48 23 3 164 3 xerC Tyrosine recombinase XerC Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
Q4L5V4 5.07e-05 48 24 6 190 3 xerC Tyrosine recombinase XerC Staphylococcus haemolyticus (strain JCSC1435)
Q7ZAK0 5.15e-05 48 24 8 209 3 xerC Tyrosine recombinase XerC Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
A8F7B4 6.05e-05 48 23 11 298 3 Tlet_1492 Tyrosine recombinase Tlet_1492 Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO)
Q7ZAM3 7.95e-05 47 26 9 238 3 xerD Tyrosine recombinase XerD Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q4L6J7 0.000102 47 19 6 240 3 xerD Tyrosine recombinase XerD Staphylococcus haemolyticus (strain JCSC1435)
Q5HP53 0.000106 47 20 6 235 3 xerD Tyrosine recombinase XerD Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
A5URM3 0.00012 47 26 8 201 3 xerC Tyrosine recombinase XerC Roseiflexus sp. (strain RS-1)
P46352 0.000145 47 23 8 228 3 xerD Tyrosine recombinase XerD Bacillus subtilis (strain 168)
Q4K3W0 0.000147 47 25 5 173 3 xerC Tyrosine recombinase XerC Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q7ZAJ8 0.000167 46 24 7 226 3 xerD Tyrosine recombinase XerD Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q93C64 0.000177 46 24 9 233 3 xerD Tyrosine recombinase XerD Lacticaseibacillus casei
Q8RA66 0.000181 47 24 9 227 3 xerC Tyrosine recombinase XerC Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
B3E1H7 0.000192 46 24 5 155 3 xerC Tyrosine recombinase XerC Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
O59490 0.000198 46 23 7 165 3 xerA Tyrosine recombinase XerA Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q9PD96 0.000235 46 22 7 248 3 xerC Tyrosine recombinase XerC Xylella fastidiosa (strain 9a5c)
B3DQV1 0.000291 46 24 4 160 3 xerC Tyrosine recombinase XerC Bifidobacterium longum (strain DJO10A)
A4VGW3 0.000325 45 23 7 225 3 xerC Tyrosine recombinase XerC Stutzerimonas stutzeri (strain A1501)
B7GQE1 0.000347 45 24 4 160 3 xerC Tyrosine recombinase XerC Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
Q500B4 0.000359 45 24 5 206 3 xerC Tyrosine recombinase XerC Pseudomonas syringae pv. syringae (strain B728a)
B6YWN8 0.000428 45 21 5 225 3 xerA Tyrosine recombinase XerA Thermococcus onnurineus (strain NA1)
P96629 0.000613 45 22 9 218 3 int ICEBs1 integrase Bacillus subtilis (strain 168)
A0LEB8 0.000673 45 34 2 70 3 xerC Tyrosine recombinase XerC Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
O31207 0.000756 44 23 8 231 1 xerC Tyrosine recombinase XerC Proteus mirabilis

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS06340
Feature type CDS
Gene -
Product site-specific integrase
Location 1318441 - 1319592 (strand: 1)
Length 1152 (nucleotides) / 383 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_110
Orthogroup size 11
N. genomes 6

Actions

Genomic region

Domains

PF00589 Phage integrase family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4974 Replication, recombination and repair (L) L Site-specific recombinase XerD

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03111 single-strand DNA-binding protein DNA replication
Mismatch repair
Homologous recombination		 -

Protein Sequence

MSIFRRGETWYASYSHNGKRIKESLGTTDKKQAQELHDKRKAELWRVSALGETPKVTFEVACTRWLEEKSGKKSLDDDKTKILFWLDHFEGMHLADIDEIKIYDAVSKLKNQKQEENWEKHVAGRKRRPVSKKSEPVSVATKAAYLAFIKSLLRAAERDWRYLDKAPNIRVPKPKNNRIRWLEPWEAKRLIDECSEPLKSVVTFALATGLRRSNIVNLEWSQIDMPRKVAWIHPDQTKSGKALGVALNDTACKVLREQIGNHTKYVFVHTKAKNRSDGSMTPVIRKMRVDGNTAFRTALKRAGIENFRFHDLRHTWASWLIQAGVPLSVLQEMGGWESIEMVRRYAHLAPRHLSQHAQQIDAVFGEDVPNMSHTALSVVGECK

Flanking regions ( +/- flanking 50bp)

AAAATGCACAATACGCCTGAAAGCGTGATTAGTGCGGAAGAGGAAAGGACATGTCAATCTTCCGGAGAGGTGAGACCTGGTACGCCAGTTACTCGCACAATGGTAAAAGAATTAAGGAGTCGCTTGGTACAACGGACAAAAAGCAAGCGCAGGAGTTGCATGATAAACGAAAGGCCGAGCTGTGGCGTGTAAGCGCACTTGGTGAAACTCCGAAGGTTACTTTTGAGGTTGCCTGCACGCGGTGGCTTGAGGAAAAATCAGGTAAAAAATCACTTGATGATGATAAGACCAAAATCCTGTTCTGGCTCGATCACTTTGAAGGGATGCACCTAGCAGATATTGATGAAATTAAAATCTATGATGCTGTCAGCAAGCTGAAAAATCAGAAGCAGGAAGAGAACTGGGAAAAGCATGTCGCCGGCAGGAAACGGCGTCCCGTCAGTAAGAAATCAGAACCGGTTTCTGTGGCAACCAAAGCCGCCTACCTTGCCTTTATTAAGTCCCTACTCCGCGCTGCCGAACGTGACTGGAGATATCTCGATAAAGCCCCGAACATCCGGGTGCCAAAACCGAAGAACAACCGGATACGCTGGCTGGAGCCGTGGGAAGCAAAACGCCTGATCGATGAATGCAGTGAGCCGCTTAAATCTGTCGTTACATTTGCTCTCGCTACCGGTCTGAGACGTTCCAATATTGTTAATCTGGAATGGTCACAGATAGATATGCCGAGAAAAGTAGCCTGGATTCATCCGGATCAGACCAAGTCAGGAAAGGCGCTGGGCGTTGCTTTGAACGATACTGCATGTAAAGTTCTGCGGGAACAGATAGGCAACCACACTAAATATGTTTTTGTTCATACAAAGGCAAAAAACAGATCTGATGGCTCAATGACTCCGGTTATCAGAAAAATGCGGGTTGACGGAAACACTGCGTTCAGGACTGCACTTAAACGTGCCGGTATTGAAAACTTCCGGTTTCATGACCTGCGGCACACATGGGCGAGTTGGTTAATTCAGGCGGGCGTACCACTGTCTGTGTTGCAGGAAATGGGAGGATGGGAGTCAATCGAAATGGTACGGCGTTATGCTCACCTGGCACCGAGACATTTAAGCCAGCACGCACAGCAAATTGATGCCGTTTTTGGTGAGGATGTCCCAAATATGTCCCACACCGCGCTAAGTGTAGTTGGTGAGTGCAAATGAAAAACCCGCTAACTGGTTGAGAGTTAACGGGTTTTATATGGTGCCGGCTA