Homologs in group_110

Help

10 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00360 FBDBKF_00360 60.1 Morganella morganii S1 - Integrase
FBDBKF_11145 FBDBKF_11145 100.0 Morganella morganii S1 xerD Site-specific recombinase XerD
EHELCC_01185 EHELCC_01185 60.1 Morganella morganii S2 - Integrase
EHELCC_05080 EHELCC_05080 100.0 Morganella morganii S2 xerD Site-specific recombinase XerD
NLDBIP_02275 NLDBIP_02275 60.1 Morganella morganii S4 - Integrase
NLDBIP_05400 NLDBIP_05400 100.0 Morganella morganii S4 xerD Site-specific recombinase XerD
LHKJJB_03790 LHKJJB_03790 60.1 Morganella morganii S3 - Integrase
HKOGLL_03255 HKOGLL_03255 60.1 Morganella morganii S5 - Integrase
HKOGLL_15660 HKOGLL_15660 100.0 Morganella morganii S5 xerD Site-specific recombinase XerD
F4V73_RS06340 F4V73_RS06340 63.9 Morganella psychrotolerans - site-specific integrase

Distribution of the homologs in the orthogroup group_110

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_110

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P24218 0.0 587 70 0 379 3 intD Prophage integrase IntD Escherichia coli (strain K12)
P04890 0.0 566 68 0 386 3 int Integrase Salmonella phage P22
P10487 2.78e-18 89 31 6 223 3 rci Shufflon-specific DNA recombinase Escherichia coli
P16470 2.92e-18 89 31 6 223 3 rci Shufflon-specific DNA recombinase Escherichia coli
P06723 3.46e-13 73 24 14 373 3 int Integrase Escherichia phage 186
Q980D9 4.58e-12 69 27 7 236 1 xerA Tyrosine recombinase XerA Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
P21442 1.88e-10 65 27 8 229 1 int Integrase Haemophilus phage HP1 (strain HP1c1)
Q8R890 1.21e-08 60 24 6 200 3 TTE2127 Tyrosine recombinase XerC-like Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q1RHT1 5.91e-08 57 26 6 199 3 xerD Tyrosine recombinase XerD Rickettsia bellii (strain RML369-C)
P22877 1.63e-07 56 34 4 101 3 int Integrase Saccharopolyspora erythraea
Q92IC9 1.97e-07 55 25 8 206 3 xerD Tyrosine recombinase XerD Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q7ZAP1 2.16e-07 55 25 6 229 3 xerD Tyrosine recombinase XerD Bifidobacterium longum (strain NCC 2705)
Q49XU5 5.13e-07 54 22 8 238 3 xerD Tyrosine recombinase XerD Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
A0LEB8 5.17e-07 54 27 7 176 3 xerC Tyrosine recombinase XerC Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Q7ZAM5 5.67e-07 54 24 9 231 3 xerC Tyrosine recombinase XerC Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
B7IFN3 5.93e-07 54 27 8 220 3 THA_404 Tyrosine recombinase THA_404 Thermosipho africanus (strain TCF52B)
Q9V1P5 6.38e-07 53 27 6 159 1 xerA Tyrosine recombinase XerA Pyrococcus abyssi (strain GE5 / Orsay)
B5YFZ8 6.71e-07 54 24 8 237 3 xerC Tyrosine recombinase XerC Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
Q38067 8.98e-07 53 25 9 235 3 None Putative integrase Pseudomonas phage Pf1
Q8TZV9 9.18e-07 53 21 6 243 3 xerA Tyrosine recombinase XerA Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q48733 1.32e-06 53 22 9 241 3 xerC Tyrosine recombinase XerC Lactobacillus leichmannii
P0A0P1 1.5e-06 53 22 8 238 3 xerD Tyrosine recombinase XerD Staphylococcus aureus (strain MW2)
P0A0P2 1.5e-06 53 22 8 238 3 xerD Tyrosine recombinase XerD Staphylococcus aureus
Q6G967 1.5e-06 53 22 8 238 3 xerD Tyrosine recombinase XerD Staphylococcus aureus (strain MSSA476)
Q6GGK1 1.5e-06 53 22 8 238 3 xerD Tyrosine recombinase XerD Staphylococcus aureus (strain MRSA252)
P0A0P0 1.5e-06 53 22 8 238 1 xerD Tyrosine recombinase XerD Staphylococcus aureus (strain N315)
P0A0N9 1.5e-06 53 22 8 238 3 xerD Tyrosine recombinase XerD Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HFS5 1.5e-06 53 22 8 238 3 xerD Tyrosine recombinase XerD Staphylococcus aureus (strain COL)
Q8NNZ9 2.62e-06 52 25 4 159 3 xerC Tyrosine recombinase XerC Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q5HP53 2.72e-06 52 24 9 228 3 xerD Tyrosine recombinase XerD Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q7ZAJ2 5.22e-06 51 24 9 228 3 xerD Tyrosine recombinase XerD Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q1I301 5.82e-06 51 25 10 244 3 xerC Tyrosine recombinase XerC Pseudomonas entomophila (strain L48)
Q4L6J7 6.03e-06 51 22 8 229 3 xerD Tyrosine recombinase XerD Staphylococcus haemolyticus (strain JCSC1435)
C4ZGY6 6.35e-06 51 26 6 153 3 EUBREC_2677 Tyrosine recombinase EUBREC_2677 Agathobacter rectalis (strain ATCC 33656 / DSM 3377 / JCM 17463 / KCTC 5835 / VPI 0990)
Q7ZAK0 8.09e-06 50 25 4 168 3 xerC Tyrosine recombinase XerC Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q4L5V4 9.56e-06 50 25 6 158 3 xerC Tyrosine recombinase XerC Staphylococcus haemolyticus (strain JCSC1435)
A5WAU7 1.35e-05 50 25 9 243 3 xerC Tyrosine recombinase XerC Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
C1DJ58 1.5e-05 50 22 7 262 3 xerC Tyrosine recombinase XerC Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q4UM01 1.55e-05 50 25 8 208 3 xerD Tyrosine recombinase XerD Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q9KA25 1.81e-05 49 23 9 232 3 xerC Tyrosine recombinase XerC Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
O59490 2.18e-05 49 25 7 167 3 xerA Tyrosine recombinase XerA Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q88CF1 2.67e-05 49 25 9 243 3 xerC Tyrosine recombinase XerC Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KQ43 3.26e-05 48 25 9 248 3 xerC Tyrosine recombinase XerC Pseudomonas putida (strain GB-1)
A7NFG3 3.28e-05 48 24 10 211 3 xerC Tyrosine recombinase XerC Roseiflexus castenholzii (strain DSM 13941 / HLO8)
Q9CPF0 3.29e-05 48 22 7 226 3 xerD Tyrosine recombinase XerD Pasteurella multocida (strain Pm70)
A8FD78 4.54e-05 48 22 10 227 3 xerC Tyrosine recombinase XerC Bacillus pumilus (strain SAFR-032)
Q49X37 5.62e-05 48 24 6 160 3 xerC Tyrosine recombinase XerC Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q93C64 6.7e-05 47 23 9 234 3 xerD Tyrosine recombinase XerD Lacticaseibacillus casei
B1J1V8 9.17e-05 47 25 10 248 3 xerC Tyrosine recombinase XerC Pseudomonas putida (strain W619)
P44630 9.6e-05 47 23 7 226 3 xerD Tyrosine recombinase XerD Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8X574 0.000102 47 23 14 314 3 xerD Tyrosine recombinase XerD Escherichia coli O157:H7
Q0VM16 0.000124 47 23 9 255 3 xerC Tyrosine recombinase XerC Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q7ZAM0 0.000137 47 23 14 314 3 xerD Tyrosine recombinase XerD Shigella flexneri
P0A8P8 0.000147 47 23 14 314 1 xerD Tyrosine recombinase XerD Escherichia coli (strain K12)
P0A8P9 0.000147 47 23 14 314 3 xerD Tyrosine recombinase XerD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q4K3W0 0.000232 46 23 7 246 3 xerC Tyrosine recombinase XerC Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
P46352 0.000248 46 22 8 236 3 xerD Tyrosine recombinase XerD Bacillus subtilis (strain 168)
P0A2P6 0.000299 45 24 10 237 1 xerD Tyrosine recombinase XerD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2P7 0.000299 45 24 10 237 3 xerD Tyrosine recombinase XerD Salmonella typhi
Q9ZDG8 0.000299 45 24 8 212 3 xerD Tyrosine recombinase XerD Rickettsia prowazekii (strain Madrid E)
Q5JHA3 0.000303 45 24 8 244 3 xerA Tyrosine recombinase XerA Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q7MNQ0 0.000306 45 23 7 231 3 xerD Tyrosine recombinase XerD Vibrio vulnificus (strain YJ016)
Q7ZAJ0 0.000306 45 23 7 231 3 xerD Tyrosine recombinase XerD Vibrio vulnificus (strain CMCP6)
B3E1H7 0.000325 45 24 5 161 3 xerC Tyrosine recombinase XerC Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
Q8NQL5 0.000352 45 33 2 68 3 xerD Tyrosine recombinase XerD Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q7ZAN4 0.000441 45 21 11 313 3 xerD Tyrosine recombinase XerD Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q7ZAJ8 0.000463 45 24 9 217 3 xerD Tyrosine recombinase XerD Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q9KPE9 0.000528 45 19 10 309 3 xerD Tyrosine recombinase XerD Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q1D804 0.000644 45 23 8 246 3 xerC Tyrosine recombinase XerC Myxococcus xanthus (strain DK1622)
P59818 0.000644 45 23 8 246 3 xerC Tyrosine recombinase XerC Myxococcus xanthus
Q8XTL6 0.000799 44 23 5 185 3 xerC2 Tyrosine recombinase XerC 2 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_02280
Feature type CDS
Gene xerD
Product Site-specific recombinase XerD
Location 22028 - 23191 (strand: 1)
Length 1164 (nucleotides) / 387 (amino acids)

Contig

Accession ZDB_360
Length 302856 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_110
Orthogroup size 11
N. genomes 6

Actions

Genomic region

Domains

PF00589 Phage integrase family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4974 Replication, recombination and repair (L) L Site-specific recombinase XerD

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03111 single-strand DNA-binding protein DNA replication
Mismatch repair
Homologous recombination		 -

Protein Sequence

MSIFKRGNSWYCDFATPGGKRIKKSLGTSDRKQAQELHDKLKAEQWRIEQVGDFPDYTYEEACLRWLEEKADKKSIEDDKNFIAFWLEYFEGVRLKDITENAIYKIISKMTNKHAENCWRRKAVTAKRKGKEVPLFTAKPVTTATKARYLSFIKALLRAAEREWKWIEKSPVIKIPSIRDRRVRWLEPVEAKRLIDECPEPLKSVVRFALSTGLRRSNILNLEWQQIDMQRKVAWIYPEDSKSGKAIGVALNDTACRVLRSQIGRHHKWVFVHTEPSYRNDGTPVAAVRKMRTDSNTAWRASLKRAGIDDFRFHDLRHTWASWLIQSGVPLSVLQEMGGWESIEMVRRYAHLAPNHLTEHAKQIDAIFDSYVPNTSQGEKLASGDNR

Flanking regions ( +/- flanking 50bp)

CCGATCAACACTATCGCCGAGAGCGAGATTGATGTGAAAGGAGATCACAAATGTCAATCTTCAAACGTGGTAACTCTTGGTATTGCGACTTCGCGACACCTGGCGGCAAGAGAATTAAAAAGTCGCTTGGTACGTCCGACCGGAAGCAAGCCCAGGAGCTGCACGACAAATTAAAGGCCGAGCAATGGCGAATTGAGCAGGTAGGTGACTTCCCGGACTATACCTATGAGGAAGCCTGCCTGCGGTGGCTTGAGGAAAAAGCGGATAAAAAATCGATAGAAGATGATAAGAACTTTATCGCTTTCTGGCTTGAGTACTTCGAGGGTGTCCGGCTGAAGGATATAACCGAGAATGCCATCTACAAGATCATCAGCAAGATGACAAACAAGCATGCTGAAAACTGCTGGAGAAGGAAAGCCGTCACAGCAAAAAGGAAGGGAAAGGAGGTGCCGCTGTTTACAGCGAAGCCTGTCACGACGGCCACAAAGGCGCGATACCTTTCTTTCATTAAGGCGCTACTCAGAGCGGCGGAAAGAGAATGGAAGTGGATAGAAAAGTCACCTGTGATAAAAATACCCTCTATTCGTGATCGGAGAGTCCGGTGGCTTGAGCCTGTCGAGGCGAAAAGGCTGATTGATGAATGTCCGGAGCCGTTAAAGTCAGTCGTCAGGTTCGCTCTGTCAACCGGCCTGCGTCGTTCGAACATACTTAATCTTGAGTGGCAGCAGATAGACATGCAGCGGAAAGTGGCATGGATTTACCCTGAAGACAGTAAATCAGGCAAAGCAATTGGTGTAGCCCTGAACGATACCGCATGCAGGGTTTTGCGCAGCCAGATTGGTCGCCATCACAAATGGGTATTTGTCCACACTGAACCGTCATACAGGAATGACGGAACACCGGTTGCGGCAGTGAGAAAGATGAGGACGGATTCTAATACCGCATGGAGAGCATCATTAAAAAGAGCCGGTATCGACGATTTCCGTTTCCATGACCTGAGACACACCTGGGCAAGCTGGCTGATCCAGTCTGGCGTTCCGCTTTCAGTGTTACAGGAAATGGGCGGGTGGGAGTCGATAGAAATGGTGCGCAGATATGCCCATCTGGCACCAAATCATCTTACCGAACATGCGAAGCAAATAGATGCCATTTTTGACAGTTACGTCCCAAATACGTCCCAAGGTGAAAAACTGGCATCGGGAGATAATCGCTAACTCTTTGATAAGTAATGGTGCCGGATACCGGATTCGAACTGGTGACCTTT