Homologs in group_110

Help

10 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_11145 FBDBKF_11145 60.1 Morganella morganii S1 xerD Site-specific recombinase XerD
EHELCC_01185 EHELCC_01185 100.0 Morganella morganii S2 - Integrase
EHELCC_05080 EHELCC_05080 60.1 Morganella morganii S2 xerD Site-specific recombinase XerD
NLDBIP_02275 NLDBIP_02275 100.0 Morganella morganii S4 - Integrase
NLDBIP_05400 NLDBIP_05400 60.1 Morganella morganii S4 xerD Site-specific recombinase XerD
LHKJJB_02280 LHKJJB_02280 60.1 Morganella morganii S3 xerD Site-specific recombinase XerD
LHKJJB_03790 LHKJJB_03790 100.0 Morganella morganii S3 - Integrase
HKOGLL_03255 HKOGLL_03255 100.0 Morganella morganii S5 - Integrase
HKOGLL_15660 HKOGLL_15660 60.1 Morganella morganii S5 xerD Site-specific recombinase XerD
F4V73_RS06340 F4V73_RS06340 59.3 Morganella psychrotolerans - site-specific integrase

Distribution of the homologs in the orthogroup group_110

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_110

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P24218 3.05e-170 483 60 0 380 3 intD Prophage integrase IntD Escherichia coli (strain K12)
P04890 3.54e-163 465 58 0 378 3 int Integrase Salmonella phage P22
P10487 9.84e-15 78 29 6 247 3 rci Shufflon-specific DNA recombinase Escherichia coli
P16470 1.11e-14 78 29 6 247 3 rci Shufflon-specific DNA recombinase Escherichia coli
P06723 1.76e-11 68 27 8 239 3 int Integrase Escherichia phage 186
P76056 3.03e-10 65 24 12 322 3 intR Prophage integrase IntR Escherichia coli (strain K12)
P21442 8.49e-10 63 26 8 227 1 int Integrase Haemophilus phage HP1 (strain HP1c1)
Q7ZAP1 2.73e-09 61 27 9 236 3 xerD Tyrosine recombinase XerD Bifidobacterium longum (strain NCC 2705)
A7NFG3 3.14e-09 61 24 13 324 3 xerC Tyrosine recombinase XerC Roseiflexus castenholzii (strain DSM 13941 / HLO8)
Q8TZV9 1.32e-08 59 25 9 197 3 xerA Tyrosine recombinase XerA Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q8R890 8.49e-08 57 24 9 250 3 TTE2127 Tyrosine recombinase XerC-like Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q8P550 1.61e-07 56 25 6 204 3 xerC Tyrosine recombinase XerC Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RNK3 1.61e-07 56 25 6 204 3 xerC Tyrosine recombinase XerC Xanthomonas campestris pv. campestris (strain B100)
Q4UYY0 1.61e-07 56 25 6 204 3 xerC Tyrosine recombinase XerC Xanthomonas campestris pv. campestris (strain 8004)
Q5JHA3 4.13e-07 54 26 7 196 3 xerA Tyrosine recombinase XerA Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q9KA25 5.16e-07 54 25 10 233 3 xerC Tyrosine recombinase XerC Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q7ZAM5 9.57e-07 53 24 10 232 3 xerC Tyrosine recombinase XerC Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
B7IFN3 1.49e-06 52 25 7 224 3 THA_404 Tyrosine recombinase THA_404 Thermosipho africanus (strain TCF52B)
Q38067 1.98e-06 52 25 9 228 3 None Putative integrase Pseudomonas phage Pf1
Q039E1 3.86e-06 51 27 3 152 3 xerC Tyrosine recombinase XerC Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B3WEA7 3.86e-06 51 27 3 152 3 xerC Tyrosine recombinase XerC Lacticaseibacillus casei (strain BL23)
Q980D9 4.11e-06 51 25 13 284 1 xerA Tyrosine recombinase XerA Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q8NNZ9 4.43e-06 51 27 5 161 3 xerC Tyrosine recombinase XerC Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q1RHT1 4.65e-06 51 25 6 189 3 xerD Tyrosine recombinase XerD Rickettsia bellii (strain RML369-C)
B3E1H7 5.22e-06 51 26 9 227 3 xerC Tyrosine recombinase XerC Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
A5URM3 5.77e-06 51 24 8 253 3 xerC Tyrosine recombinase XerC Roseiflexus sp. (strain RS-1)
Q7ZAK0 8.02e-06 50 25 2 159 3 xerC Tyrosine recombinase XerC Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
P22877 1.09e-05 50 43 0 58 3 int Integrase Saccharopolyspora erythraea
P96629 1.2e-05 50 21 17 405 3 int ICEBs1 integrase Bacillus subtilis (strain 168)
B5YFZ8 1.6e-05 49 24 10 260 3 xerC Tyrosine recombinase XerC Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
Q49XU5 2.08e-05 49 24 8 223 3 xerD Tyrosine recombinase XerD Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q4L6J7 2.53e-05 49 23 9 226 3 xerD Tyrosine recombinase XerD Staphylococcus haemolyticus (strain JCSC1435)
Q92A53 2.95e-05 48 24 10 227 3 xerD Tyrosine recombinase XerD Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q8PPP9 3.28e-05 48 24 6 204 3 xerC Tyrosine recombinase XerC Xanthomonas axonopodis pv. citri (strain 306)
Q9HXQ6 3.37e-05 48 27 12 236 3 xerD Tyrosine recombinase XerD Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A8FD78 3.4e-05 48 23 10 239 3 xerC Tyrosine recombinase XerC Bacillus pumilus (strain SAFR-032)
B3DQV1 4.46e-05 48 25 3 158 3 xerC Tyrosine recombinase XerC Bifidobacterium longum (strain DJO10A)
B6YWN8 4.48e-05 48 25 8 194 3 xerA Tyrosine recombinase XerA Thermococcus onnurineus (strain NA1)
O59490 4.55e-05 48 23 9 199 3 xerA Tyrosine recombinase XerA Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
P9WMB3 4.68e-05 48 20 11 367 1 Rv2659c Putative prophage phiRv2 integrase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMB2 4.68e-05 48 20 11 367 3 MT2735 Putative prophage phiRv2 integrase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A1AKP9 5.09e-05 48 23 8 230 3 xerC Tyrosine recombinase XerC Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
B7GQE1 5.52e-05 48 26 3 152 3 xerC Tyrosine recombinase XerC Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
Q8Y5V0 5.7e-05 48 24 10 227 3 xerD Tyrosine recombinase XerD Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q71Y59 5.7e-05 48 24 10 227 3 xerD Tyrosine recombinase XerD Listeria monocytogenes serotype 4b (strain F2365)
Q0VM16 6.38e-05 48 21 7 232 3 xerC Tyrosine recombinase XerC Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q92ME3 7.68e-05 47 30 5 160 3 xerD Tyrosine recombinase XerD Rhizobium meliloti (strain 1021)
Q1D804 8.2e-05 47 23 8 225 3 xerC Tyrosine recombinase XerC Myxococcus xanthus (strain DK1622)
P59818 8.2e-05 47 23 8 225 3 xerC Tyrosine recombinase XerC Myxococcus xanthus
Q8RA66 0.000104 47 26 10 231 3 xerC Tyrosine recombinase XerC Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q7ZAM7 0.000107 47 22 8 224 3 xerD Tyrosine recombinase XerD Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72SA5 0.000107 47 22 8 224 3 xerD Tyrosine recombinase XerD Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
A0LEB8 0.000139 47 26 8 176 3 xerC Tyrosine recombinase XerC Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Q9V1P5 0.000159 46 24 7 170 1 xerA Tyrosine recombinase XerA Pyrococcus abyssi (strain GE5 / Orsay)
Q4L5V4 0.00021 46 27 7 154 3 xerC Tyrosine recombinase XerC Staphylococcus haemolyticus (strain JCSC1435)
Q7ZAJ8 0.000214 46 28 11 230 3 xerD Tyrosine recombinase XerD Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
P55632 0.000269 46 26 8 212 3 NGR_a01870 Putative integrase/recombinase y4qK Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P55429 0.000302 45 26 6 208 3 NGR_a03870 Putative integrase/recombinase y4eF Sinorhizobium fredii (strain NBRC 101917 / NGR234)
C1DJ58 0.000337 45 28 5 158 3 xerC Tyrosine recombinase XerC Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
P39776 0.000353 45 23 10 231 1 xerC Tyrosine recombinase XerC Bacillus subtilis (strain 168)
O31207 0.000397 45 27 5 158 1 xerC Tyrosine recombinase XerC Proteus mirabilis
P0A055 0.00042 46 28 2 103 3 tnpB Transposase B from transposon Tn554 Staphylococcus aureus
P0A054 0.00042 46 28 2 103 3 tnpB1 Transposase B from transposon Tn554 Staphylococcus aureus (strain N315)
P0A053 0.00042 46 28 2 103 3 tnpB1 Transposase B from transposon Tn554 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q7ZAJ4 0.000421 45 21 7 265 3 xerC Tyrosine recombinase XerC Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HPU0 0.000421 45 21 7 265 3 xerC Tyrosine recombinase XerC Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q7MNQ0 0.000431 45 25 9 233 3 xerD Tyrosine recombinase XerD Vibrio vulnificus (strain YJ016)
Q7ZAJ0 0.000431 45 25 9 233 3 xerD Tyrosine recombinase XerD Vibrio vulnificus (strain CMCP6)
P76168 0.000431 45 22 8 240 1 intQ Putative defective protein IntQ Escherichia coli (strain K12)
Q8XTL6 0.000453 45 25 8 177 3 xerC2 Tyrosine recombinase XerC 2 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q92IC9 0.000665 45 45 0 44 3 xerD Tyrosine recombinase XerD Rickettsia conorii (strain ATCC VR-613 / Malish 7)
P45198 0.00084 44 23 4 131 3 HI_1424 Putative integrase/recombinase HI_1414 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A6VQS4 0.001 44 23 5 155 3 xerC Tyrosine recombinase XerC Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_00360
Feature type CDS
Gene -
Product Integrase
Location 46239 - 47390 (strand: 1)
Length 1152 (nucleotides) / 383 (amino acids)

Contig

Accession contig_1
Length 309072 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_110
Orthogroup size 11
N. genomes 6

Actions

Genomic region

Domains

PF00589 Phage integrase family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4974 Replication, recombination and repair (L) L Site-specific recombinase XerD

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03111 single-strand DNA-binding protein DNA replication
Mismatch repair
Homologous recombination		 -

Protein Sequence

MSIKLRYGVWHCDFVSPSGKRIRRSLETSDKRQAQELHDQLKAEAWRVEKLGDYPSVTFDDACLRWLQEKEHKKSLDDDKTKIEYFLQFFSGKLLSSITETDILKATSGMINRKHKEVWEIKAASAKKKGAKIAPYKPKPATQATKDRYLAFLRSLFRAAVNDWKWIGKSPTIKVRQKKEIRVRWLTKEEATTLIQCMPDVMKPVVMFALATGLRRSNILNLEWTQIDLQRKVAWIHPEDTKGGKAIGVALNETACRVLRMQIGKHQQYVFVHTEAWHRADGSPTEKVRKMRVDDNTAWNTGLRRAGITNFRFHDLRHTWASWLVQAGVPLTALQEMGGWESIEMVQRYAHLAPNHLVEHARRIDEAMGINGTNMARALIKAV

Flanking regions ( +/- flanking 50bp)

TGCAGAGCGAGTGATGATGATGCTGATAAATCGAAGGAGAGATTTAATCAATGTCAATCAAATTACGGTATGGCGTGTGGCACTGTGATTTCGTTTCCCCGAGTGGTAAGCGAATTAGACGAAGCCTTGAAACATCGGACAAAAGGCAAGCGCAGGAGCTGCATGACCAATTAAAGGCCGAAGCGTGGCGTGTCGAAAAGCTGGGGGACTACCCTTCTGTAACCTTTGATGATGCATGCCTACGTTGGCTCCAGGAAAAGGAGCATAAAAAATCACTGGATGATGACAAAACCAAAATTGAATATTTTCTTCAGTTCTTTTCCGGGAAATTATTGTCATCAATAACAGAGACAGACATCTTAAAAGCAACGTCAGGGATGATAAACAGGAAGCATAAGGAGGTGTGGGAAATAAAGGCGGCGTCAGCAAAGAAGAAAGGTGCCAAAATTGCGCCATATAAACCAAAACCGGCAACTCAGGCAACAAAGGACAGGTATCTTGCCTTTTTGCGCTCTCTTTTCAGAGCGGCTGTTAATGACTGGAAGTGGATCGGGAAATCACCAACAATTAAAGTCAGGCAAAAAAAGGAAATACGGGTCAGGTGGCTGACCAAAGAAGAAGCAACAACCCTGATACAGTGTATGCCTGATGTAATGAAGCCTGTCGTTATGTTTGCACTCGCAACCGGATTGCGCAGGTCTAACATACTTAATCTAGAATGGACGCAAATAGACCTGCAACGGAAAGTTGCCTGGATTCATCCGGAAGATACGAAAGGCGGCAAGGCAATAGGTGTGGCTCTCAACGAAACAGCTTGTCGGGTACTCAGGATGCAAATTGGAAAGCACCAGCAATACGTGTTTGTGCACACTGAAGCGTGGCACAGAGCTGACGGATCACCAACAGAAAAAGTAAGGAAGATGAGAGTCGACGACAACACTGCATGGAATACTGGGCTTCGCCGAGCAGGAATAACAAATTTCCGCTTCCATGACCTTCGCCACACGTGGGCGAGCTGGCTCGTTCAGGCCGGAGTCCCGCTGACTGCGTTACAGGAAATGGGAGGGTGGGAATCGATAGAAATGGTTCAGAGGTACGCACATTTAGCCCCGAATCATCTTGTTGAACACGCGCGAAGAATTGACGAGGCCATGGGGATTAATGGCACGAATATGGCACGCGCACTAATAAAAGCGGTCTAACCATGCATCATATAGAAAAGAAAAACCCGCTATATCTGTGAAATATAACG