Homologs in group_1422

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08780 FBDBKF_08780 72.1 Morganella morganii S1 nrdG anaerobic ribonucleoside-triphosphate reductase-activating protein
EHELCC_12745 EHELCC_12745 72.1 Morganella morganii S2 nrdG anaerobic ribonucleoside-triphosphate reductase-activating protein
NLDBIP_13085 NLDBIP_13085 72.1 Morganella morganii S4 nrdG anaerobic ribonucleoside-triphosphate reductase-activating protein
LHKJJB_13470 LHKJJB_13470 72.1 Morganella morganii S3 nrdG anaerobic ribonucleoside-triphosphate reductase-activating protein
HKOGLL_11560 HKOGLL_11560 72.1 Morganella morganii S5 nrdG anaerobic ribonucleoside-triphosphate reductase-activating protein
F4V73_RS09995 F4V73_RS09995 72.7 Morganella psychrotolerans nrdG anaerobic ribonucleoside-triphosphate reductase-activating protein

Distribution of the homologs in the orthogroup group_1422

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1422

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q9KM76 3.94e-89 259 74 0 153 3 nrdG Anaerobic ribonucleoside-triphosphate reductase-activating protein Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P0A9N8 6.6e-87 253 73 0 154 1 nrdG Anaerobic ribonucleoside-triphosphate reductase-activating protein Escherichia coli (strain K12)
P0A9N9 6.6e-87 253 73 0 154 3 nrdG Anaerobic ribonucleoside-triphosphate reductase-activating protein Escherichia coli O157:H7
Q8Z138 2.78e-86 252 73 0 154 3 nrdG Anaerobic ribonucleoside-triphosphate reductase-activating protein Salmonella typhi
Q9L645 4.86e-86 251 73 0 154 3 nrdG Anaerobic ribonucleoside-triphosphate reductase-activating protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9CM94 8.77e-76 225 63 1 155 3 nrdG Anaerobic ribonucleoside-triphosphate reductase-activating protein Pasteurella multocida (strain Pm70)
P45080 1.85e-75 224 63 0 154 3 nrdG Anaerobic ribonucleoside-triphosphate reductase-activating protein Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P07075 1.29e-47 154 50 3 148 3 NRDG Anaerobic ribonucleoside-triphosphate reductase-activating protein Enterobacteria phage T4
P43751 1.4e-07 52 29 1 75 3 pflA Pyruvate formate-lyase 1-activating enzyme Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q46267 1.47e-07 52 34 4 92 3 act Pyruvate formate-lyase-activating enzyme Clostridium pasteurianum
P0A9N7 8.07e-06 47 28 1 75 3 pflA Pyruvate formate-lyase 1-activating enzyme Shigella flexneri
P0A9N4 8.07e-06 47 28 1 75 1 pflA Pyruvate formate-lyase 1-activating enzyme Escherichia coli (strain K12)
P0A9N5 8.07e-06 47 28 1 75 3 pflA Pyruvate formate-lyase 1-activating enzyme Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9N6 8.07e-06 47 28 1 75 3 pflA Pyruvate formate-lyase 1-activating enzyme Escherichia coli O157:H7
P0A442 0.00022 43 35 1 54 3 pflA Pyruvate formate-lyase-activating enzyme Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q71ZR3 0.00022 43 35 1 54 3 pflA Pyruvate formate-lyase-activating enzyme Listeria monocytogenes serotype 4b (strain F2365)
P0A443 0.00022 43 35 1 54 3 pflA Pyruvate formate-lyase-activating enzyme Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
O68575 0.000238 43 30 2 82 3 act Pyruvate formate-lyase-activating enzyme Streptococcus mutans serotype c (strain ATCC 700610 / UA159)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS17195
Feature type CDS
Gene nrdG
Product anaerobic ribonucleoside-triphosphate reductase-activating protein
Location 3777838 - 3778302 (strand: -1)
Length 465 (nucleotides) / 154 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1422
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF13353 4Fe-4S single cluster domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1180 Posttranslational modification, protein turnover, chaperones (O) O Pyruvate-formate lyase-activating enzyme

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K04068 anaerobic ribonucleoside-triphosphate reductase activating protein [EC:1.97.1.4] - -

Protein Sequence

MNYHQYYPVDVVNGPGTRCTLFVAGCVHQCRGCYNKSTWSLTSGKPFTQEVEDQIIADLQDTRIKRQGLSLSGGDPLHPQNLSAILKLVKRVKTQCPEKDIWVWTGYLLADLTPEQQEVVSYINVLIDGKFVQELYDPALLWRGSSNQVIHKLK

Flanking regions ( +/- flanking 50bp)

AGTTAAACGTCGAGTTAAACATCTGGCTAATGGTCAGTTAGGTTAATACTGTGAATTACCATCAATATTACCCTGTTGATGTTGTCAATGGCCCAGGAACACGTTGCACCCTGTTTGTTGCAGGGTGCGTACACCAATGTCGTGGTTGCTATAATAAATCAACTTGGTCACTAACATCTGGCAAGCCGTTTACCCAAGAAGTGGAAGATCAGATCATTGCTGATTTACAAGACACTCGTATTAAACGACAAGGACTATCACTTTCCGGTGGTGATCCCCTGCACCCCCAAAATCTTTCTGCTATATTAAAATTGGTAAAACGTGTTAAAACGCAATGCCCTGAGAAAGATATTTGGGTTTGGACAGGCTATTTATTGGCTGACTTAACCCCAGAGCAACAAGAAGTCGTTAGCTATATTAACGTACTGATTGACGGCAAATTCGTACAAGAACTTTATGATCCCGCATTACTGTGGCGCGGTAGTAGTAATCAGGTGATCCATAAATTGAAGTAATACACATTGAATTAACTGGAGGATATATGCCTTTAAGTGATAATAAATAT