Homologs in group_1478

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_12745 EHELCC_12745 100.0 Morganella morganii S2 nrdG anaerobic ribonucleoside-triphosphate reductase-activating protein
NLDBIP_13085 NLDBIP_13085 100.0 Morganella morganii S4 nrdG anaerobic ribonucleoside-triphosphate reductase-activating protein
LHKJJB_13470 LHKJJB_13470 100.0 Morganella morganii S3 nrdG anaerobic ribonucleoside-triphosphate reductase-activating protein
HKOGLL_11560 HKOGLL_11560 100.0 Morganella morganii S5 nrdG anaerobic ribonucleoside-triphosphate reductase-activating protein
F4V73_RS09995 F4V73_RS09995 91.6 Morganella psychrotolerans nrdG anaerobic ribonucleoside-triphosphate reductase-activating protein
PMI_RS17195 PMI_RS17195 72.1 Proteus mirabilis HI4320 nrdG anaerobic ribonucleoside-triphosphate reductase-activating protein

Distribution of the homologs in the orthogroup group_1478

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1478

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0A9N8 1.65e-89 260 78 1 155 1 nrdG Anaerobic ribonucleoside-triphosphate reductase-activating protein Escherichia coli (strain K12)
P0A9N9 1.65e-89 260 78 1 155 3 nrdG Anaerobic ribonucleoside-triphosphate reductase-activating protein Escherichia coli O157:H7
Q9L645 8.84e-89 258 78 1 155 3 nrdG Anaerobic ribonucleoside-triphosphate reductase-activating protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z138 3.76e-88 256 77 1 155 3 nrdG Anaerobic ribonucleoside-triphosphate reductase-activating protein Salmonella typhi
Q9KM76 4.06e-80 236 70 1 152 3 nrdG Anaerobic ribonucleoside-triphosphate reductase-activating protein Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P45080 2.85e-74 221 63 1 155 3 nrdG Anaerobic ribonucleoside-triphosphate reductase-activating protein Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9CM94 6.83e-68 206 59 2 154 3 nrdG Anaerobic ribonucleoside-triphosphate reductase-activating protein Pasteurella multocida (strain Pm70)
P07075 2.01e-42 141 46 4 149 3 NRDG Anaerobic ribonucleoside-triphosphate reductase-activating protein Enterobacteria phage T4
P43751 7.41e-06 47 30 1 75 3 pflA Pyruvate formate-lyase 1-activating enzyme Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0A9N7 1.99e-05 46 32 1 75 3 pflA Pyruvate formate-lyase 1-activating enzyme Shigella flexneri
P0A9N4 1.99e-05 46 32 1 75 1 pflA Pyruvate formate-lyase 1-activating enzyme Escherichia coli (strain K12)
P0A9N5 1.99e-05 46 32 1 75 3 pflA Pyruvate formate-lyase 1-activating enzyme Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9N6 1.99e-05 46 32 1 75 3 pflA Pyruvate formate-lyase 1-activating enzyme Escherichia coli O157:H7
Q46267 5.72e-05 45 27 5 136 3 act Pyruvate formate-lyase-activating enzyme Clostridium pasteurianum
Q97D55 7.3e-05 44 30 4 95 3 queE 7-carboxy-7-deazaguanine synthase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
P0A442 0.000522 42 36 0 41 3 pflA Pyruvate formate-lyase-activating enzyme Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q71ZR3 0.000522 42 36 0 41 3 pflA Pyruvate formate-lyase-activating enzyme Listeria monocytogenes serotype 4b (strain F2365)
P0A443 0.000522 42 36 0 41 3 pflA Pyruvate formate-lyase-activating enzyme Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_08780
Feature type CDS
Gene nrdG
Product anaerobic ribonucleoside-triphosphate reductase-activating protein
Location 135628 - 136095 (strand: -1)
Length 468 (nucleotides) / 155 (amino acids)
In genomic island -

Contig

Accession contig_9
Length 163724 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1478
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF13353 4Fe-4S single cluster domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1180 Posttranslational modification, protein turnover, chaperones (O) O Pyruvate-formate lyase-activating enzyme

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K04068 anaerobic ribonucleoside-triphosphate reductase activating protein [EC:1.97.1.4] - -

Protein Sequence

MNYHQYYPVDVVNGPGTRCTLFVSGCVHQCRGCYNQSTWRTDSGVPYTRELEDMIIADLCDTRVKRQGITLSGGDPLHPHNVPEILALVQRIRRECPPEKDIWMWTGYKLDELNDAQREVIEHINVLVDGKFVQDLHDPMLIWRGSANQVIHYLR

Flanking regions ( +/- flanking 50bp)

AGTGAAGCGCCGCGTTAAACACCTGAATAACGGCCAACTGGGGTAATGCAGTGAATTATCATCAGTACTATCCCGTTGACGTGGTCAACGGGCCGGGTACACGCTGCACCCTGTTTGTCTCCGGTTGTGTGCATCAGTGCCGCGGCTGCTATAACCAGAGCACCTGGCGCACTGATTCCGGTGTGCCGTACACCCGGGAACTGGAAGATATGATTATCGCCGACCTCTGTGATACCCGCGTAAAACGTCAGGGGATCACACTGTCCGGTGGTGATCCGCTGCATCCGCACAATGTGCCGGAGATTCTGGCACTGGTGCAGCGCATCCGCCGCGAGTGCCCGCCGGAAAAAGATATCTGGATGTGGACAGGTTATAAACTGGATGAACTGAATGATGCCCAGCGGGAAGTCATTGAGCATATCAATGTGTTAGTCGACGGGAAATTTGTACAGGATCTGCATGACCCGATGCTGATCTGGCGCGGCAGTGCAAATCAGGTTATTCACTATCTGCGCTGAACCGCGACCAGTGCAGTTTCTTTCCGAACCCCAGCGTATTATTCACCATC