Homologs in group_1761

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_12260 FBDBKF_12260 85.3 Morganella morganii S1 rraA ribonuclease E activity regulator RraA
EHELCC_14045 EHELCC_14045 85.3 Morganella morganii S2 rraA ribonuclease E activity regulator RraA
NLDBIP_15140 NLDBIP_15140 85.3 Morganella morganii S4 rraA ribonuclease E activity regulator RraA
LHKJJB_15470 LHKJJB_15470 85.3 Morganella morganii S3 rraA ribonuclease E activity regulator RraA
HKOGLL_14590 HKOGLL_14590 85.3 Morganella morganii S5 rraA ribonuclease E activity regulator RraA
F4V73_RS17090 F4V73_RS17090 83.1 Morganella psychrotolerans rraA ribonuclease E activity regulator RraA

Distribution of the homologs in the orthogroup group_1761

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1761

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4F169 1.54e-120 340 100 0 172 3 rraA Regulator of ribonuclease activity A Proteus mirabilis (strain HI4320)
Q7MYB9 2.21e-99 286 84 0 167 3 rraA Regulator of ribonuclease activity A Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q3YV49 9.51e-97 279 84 0 158 3 rraA Regulator of ribonuclease activity A Shigella sonnei (strain Ss046)
P0A8R3 9.51e-97 279 84 0 158 3 rraA Regulator of ribonuclease activity A Shigella flexneri
Q31U61 9.51e-97 279 84 0 158 3 rraA Regulator of ribonuclease activity A Shigella boydii serotype 4 (strain Sb227)
B2TWC5 9.51e-97 279 84 0 158 3 rraA Regulator of ribonuclease activity A Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1R3Y9 9.51e-97 279 84 0 158 3 rraA Regulator of ribonuclease activity A Escherichia coli (strain UTI89 / UPEC)
B1LNN4 9.51e-97 279 84 0 158 3 rraA Regulator of ribonuclease activity A Escherichia coli (strain SMS-3-5 / SECEC)
B6I4S2 9.51e-97 279 84 0 158 3 rraA Regulator of ribonuclease activity A Escherichia coli (strain SE11)
B7NFM8 9.51e-97 279 84 0 158 3 rraA Regulator of ribonuclease activity A Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A8R0 9.51e-97 279 84 0 158 1 rraA Regulator of ribonuclease activity A Escherichia coli (strain K12)
B1IVF0 9.51e-97 279 84 0 158 3 rraA Regulator of ribonuclease activity A Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A8R1 9.51e-97 279 84 0 158 3 rraA Regulator of ribonuclease activity A Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TAD5 9.51e-97 279 84 0 158 3 rraA Regulator of ribonuclease activity A Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A8A735 9.51e-97 279 84 0 158 3 rraA Regulator of ribonuclease activity A Escherichia coli O9:H4 (strain HS)
B1XB95 9.51e-97 279 84 0 158 3 rraA Regulator of ribonuclease activity A Escherichia coli (strain K12 / DH10B)
C5A096 9.51e-97 279 84 0 158 3 rraA Regulator of ribonuclease activity A Escherichia coli (strain K12 / MC4100 / BW2952)
B7M6Y0 9.51e-97 279 84 0 158 3 rraA Regulator of ribonuclease activity A Escherichia coli O8 (strain IAI1)
B7MR18 9.51e-97 279 84 0 158 3 rraA Regulator of ribonuclease activity A Escherichia coli O81 (strain ED1a)
B7NU76 9.51e-97 279 84 0 158 3 rraA Regulator of ribonuclease activity A Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YZ69 9.51e-97 279 84 0 158 3 rraA Regulator of ribonuclease activity A Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A8R2 9.51e-97 279 84 0 158 3 rraA Regulator of ribonuclease activity A Escherichia coli O157:H7
B7LA26 9.51e-97 279 84 0 158 3 rraA Regulator of ribonuclease activity A Escherichia coli (strain 55989 / EAEC)
B7MI61 9.51e-97 279 84 0 158 3 rraA Regulator of ribonuclease activity A Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UNP9 9.51e-97 279 84 0 158 3 rraA Regulator of ribonuclease activity A Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZUE4 9.51e-97 279 84 0 158 3 rraA Regulator of ribonuclease activity A Escherichia coli O139:H28 (strain E24377A / ETEC)
A8AKZ4 1.31e-96 279 85 0 158 3 rraA Regulator of ribonuclease activity A Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A7ML69 1.63e-96 279 84 0 158 3 rraA Regulator of ribonuclease activity A Cronobacter sakazakii (strain ATCC BAA-894)
P67651 2.55e-96 278 84 0 158 3 rraA Regulator of ribonuclease activity A Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P67652 2.55e-96 278 84 0 158 3 rraA Regulator of ribonuclease activity A Salmonella typhi
B4TPV0 2.55e-96 278 84 0 158 3 rraA Regulator of ribonuclease activity A Salmonella schwarzengrund (strain CVM19633)
B5BJK6 2.55e-96 278 84 0 158 3 rraA Regulator of ribonuclease activity A Salmonella paratyphi A (strain AKU_12601)
C0Q439 2.55e-96 278 84 0 158 3 rraA Regulator of ribonuclease activity A Salmonella paratyphi C (strain RKS4594)
Q5PIS0 2.55e-96 278 84 0 158 3 rraA Regulator of ribonuclease activity A Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T0T6 2.55e-96 278 84 0 158 3 rraA Regulator of ribonuclease activity A Salmonella newport (strain SL254)
B4TCM6 2.55e-96 278 84 0 158 3 rraA Regulator of ribonuclease activity A Salmonella heidelberg (strain SL476)
B5RF82 2.55e-96 278 84 0 158 3 rraA Regulator of ribonuclease activity A Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QXL8 2.55e-96 278 84 0 158 3 rraA Regulator of ribonuclease activity A Salmonella enteritidis PT4 (strain P125109)
B5FPT8 2.55e-96 278 84 0 158 3 rraA Regulator of ribonuclease activity A Salmonella dublin (strain CT_02021853)
B5F0S0 2.55e-96 278 84 0 158 3 rraA Regulator of ribonuclease activity A Salmonella agona (strain SL483)
B7LUS5 3.91e-96 278 84 0 158 3 rraA Regulator of ribonuclease activity A Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A9MI36 4.27e-96 278 84 0 158 3 rraA Regulator of ribonuclease activity A Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A4WG69 4.27e-96 278 85 0 158 3 rraA Regulator of ribonuclease activity A Enterobacter sp. (strain 638)
Q57HC8 4.71e-96 278 84 0 158 3 rraA Regulator of ribonuclease activity A Salmonella choleraesuis (strain SC-B67)
Q32AA2 5.09e-96 278 84 0 158 3 rraA Regulator of ribonuclease activity A Shigella dysenteriae serotype 1 (strain Sd197)
Q0SY60 6.27e-96 277 82 0 161 3 rraA Regulator of ribonuclease activity A Shigella flexneri serotype 5b (strain 8401)
C5BB79 7.15e-96 277 83 0 161 3 rraA Regulator of ribonuclease activity A Edwardsiella ictaluri (strain 93-146)
A8GL98 2.64e-95 276 80 0 161 3 rraA Regulator of ribonuclease activity A Serratia proteamaculans (strain 568)
A6TGB9 3.75e-95 275 83 0 158 3 rraA Regulator of ribonuclease activity A Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XZ39 3.75e-95 275 83 0 158 3 rraA Regulator of ribonuclease activity A Klebsiella pneumoniae (strain 342)
Q6CZ89 3.96e-95 275 83 0 158 3 rraA Regulator of ribonuclease activity A Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C6DHM4 4.72e-95 275 83 0 158 3 rraA Regulator of ribonuclease activity A Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A1JI06 1.05e-94 274 81 0 161 3 rraA Regulator of ribonuclease activity A Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B2VES2 4.61e-94 273 83 0 158 3 rraA Regulator of ribonuclease activity A Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
B1JQ78 5.09e-94 272 80 0 161 3 rraA Regulator of ribonuclease activity A Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66G87 5.09e-94 272 80 0 161 3 rraA Regulator of ribonuclease activity A Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TS86 5.09e-94 272 80 0 161 3 rraA Regulator of ribonuclease activity A Yersinia pestis (strain Pestoides F)
Q1CD53 5.09e-94 272 80 0 161 3 rraA Regulator of ribonuclease activity A Yersinia pestis bv. Antiqua (strain Nepal516)
A9R6C5 5.09e-94 272 80 0 161 3 rraA Regulator of ribonuclease activity A Yersinia pestis bv. Antiqua (strain Angola)
Q8ZJJ7 5.09e-94 272 80 0 161 3 rraA Regulator of ribonuclease activity A Yersinia pestis
B2JZC3 5.09e-94 272 80 0 161 3 rraA Regulator of ribonuclease activity A Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1CBF0 5.09e-94 272 80 0 161 3 rraA Regulator of ribonuclease activity A Yersinia pestis bv. Antiqua (strain Antiqua)
A7FCY2 5.09e-94 272 80 0 161 3 rraA Regulator of ribonuclease activity A Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q2NQY0 5.68e-89 259 83 0 161 3 rraA Regulator of ribonuclease activity A Sodalis glossinidius (strain morsitans)
Q9KNQ9 2.49e-76 228 68 0 158 3 rraA Regulator of ribonuclease activity A Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q12S21 9.13e-76 226 65 0 161 3 rraA Regulator of ribonuclease activity A Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q87T23 1.05e-75 226 65 0 161 3 rraA Regulator of ribonuclease activity A Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q9CLP9 5.7e-75 224 66 0 162 3 rraA Regulator of ribonuclease activity A Pasteurella multocida (strain Pm70)
Q8E9R9 5.94e-75 224 65 0 158 3 rraA Regulator of ribonuclease activity A Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q8DCP6 2.95e-74 223 65 0 158 3 rraA Regulator of ribonuclease activity A Vibrio vulnificus (strain CMCP6)
Q6LVI5 3.62e-74 222 63 0 161 3 rraA Regulator of ribonuclease activity A Photobacterium profundum (strain SS9)
Q7MH54 1.24e-73 221 65 0 158 3 rraA Regulator of ribonuclease activity A Vibrio vulnificus (strain YJ016)
B0UV42 2.49e-73 220 62 0 164 3 rraA Regulator of ribonuclease activity A Histophilus somni (strain 2336)
Q0I1S4 3.78e-73 220 62 0 164 3 rraA Regulator of ribonuclease activity A Histophilus somni (strain 129Pt)
Q4QN38 1.5e-72 218 64 0 162 3 rraA Regulator of ribonuclease activity A Haemophilus influenzae (strain 86-028NP)
P44738 1.65e-72 218 64 0 162 3 rraA Regulator of ribonuclease activity A Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UH15 1.65e-72 218 64 0 162 3 rraA Regulator of ribonuclease activity A Haemophilus influenzae (strain PittGG)
A5U9Y3 1.65e-72 218 64 0 162 3 rraA Regulator of ribonuclease activity A Haemophilus influenzae (strain PittEE)
A8G0S5 1.41e-70 213 61 0 161 3 rraA Regulator of ribonuclease activity A Shewanella sediminis (strain HAW-EB3)
A6VLP4 1.77e-70 213 61 0 162 3 rraA Regulator of ribonuclease activity A Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
B8F7G7 1.87e-70 213 63 0 166 3 rraA Regulator of ribonuclease activity A Glaesserella parasuis serovar 5 (strain SH0165)
P59885 2.6e-70 213 64 0 162 3 rraA Regulator of ribonuclease activity A Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B0BTI0 5.58e-69 209 66 0 154 3 rraA Regulator of ribonuclease activity A Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A3N3J5 5.58e-69 209 66 0 154 3 rraA Regulator of ribonuclease activity A Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B3H2X0 3.63e-68 207 65 0 154 3 rraA Regulator of ribonuclease activity A Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
B4S2E4 5.44e-68 206 59 0 161 3 rraA Regulator of ribonuclease activity A Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
Q65RG4 2.93e-67 205 62 0 155 3 rraA Regulator of ribonuclease activity A Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A1SZR8 1e-65 201 61 0 158 3 rraA Regulator of ribonuclease activity A Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
C4LBS7 1.61e-65 200 59 0 161 3 rraA Regulator of ribonuclease activity A Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q15NG9 7.7e-65 199 55 0 158 3 rraA Regulator of ribonuclease activity A Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q5QV38 1.22e-64 198 58 0 158 3 rraA Regulator of ribonuclease activity A Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q3IJD2 1.64e-64 198 59 0 154 3 rraA Regulator of ribonuclease activity A Pseudoalteromonas translucida (strain TAC 125)
C1DHC2 1.5e-62 193 55 0 162 3 Avin_23290 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q47VZ9 1.26e-61 191 56 0 158 3 rraA Regulator of ribonuclease activity A Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q9I2W7 4.01e-60 187 53 0 162 1 PA1772 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02KR3 4.01e-60 187 53 0 162 1 PA14_41640 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Pseudomonas aeruginosa (strain UCBPP-PA14)
B7VBA7 4.01e-60 187 53 0 162 3 PLES_35571 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Pseudomonas aeruginosa (strain LESB58)
Q883Q6 1.52e-59 185 54 0 162 3 PSPTO_2294 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
A4VL60 3.2e-59 184 53 0 160 3 PST_2040 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Stutzerimonas stutzeri (strain A1501)
A6V753 5.53e-59 184 53 0 160 3 PSPA7_3534 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Pseudomonas aeruginosa (strain PA7)
Q4KFJ3 4.55e-58 181 51 0 161 3 PFL_1871 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q88L51 5.42e-58 181 52 0 161 3 PP_2084 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q48JZ3 6.31e-58 181 53 1 164 3 PSPPH_2063 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q1ICM4 7.61e-58 181 52 0 161 3 PSEEN1744 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Pseudomonas entomophila (strain L48)
A4XU32 8.5e-58 181 52 0 162 3 Pmen_2087 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Pseudomonas mendocina (strain ymp)
A5W6M0 9.68e-58 181 52 0 161 3 Pput_3656 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q9S4U0 2.3e-57 180 51 0 162 3 None Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Pseudomonas fluorescens
B0KG79 2.67e-57 179 53 0 157 3 PputGB1_1595 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Pseudomonas putida (strain GB-1)
Q2SK70 4.82e-57 179 49 0 163 3 HCH_02125 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Hahella chejuensis (strain KCTC 2396)
Q4ZUN7 7.16e-57 178 52 0 162 3 Psyr_2092 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Pseudomonas syringae pv. syringae (strain B728a)
Q3KFE1 1.36e-56 178 50 0 161 3 Pfl01_1772 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Pseudomonas fluorescens (strain Pf0-1)
C3K0T6 4.25e-56 176 49 0 161 3 PFLU_4617 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Pseudomonas fluorescens (strain SBW25)
B1J596 1.25e-55 175 52 0 157 3 PputW619_1602 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Pseudomonas putida (strain W619)
Q5P203 4.26e-48 156 45 0 158 3 AZOSEA25360 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
A6VX14 6.22e-48 155 45 0 160 3 Mmwyl1_2071 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Marinomonas sp. (strain MWYL1)
Q3BRB4 1.51e-47 155 44 1 161 3 XCV2968 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PIT8 4.2e-47 154 44 1 161 3 XAC2807 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Xanthomonas axonopodis pv. citri (strain 306)
Q47BF5 1.34e-46 152 45 1 162 3 Daro_3096 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Dechloromonas aromatica (strain RCB)
Q6FCF4 2.09e-46 152 50 1 150 3 ACIAD1391 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
B2SSI8 3.4e-46 151 44 1 161 3 PXO_04832 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P5H9 3.4e-46 151 44 1 161 3 XOO1443 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q8P7H4 1.57e-45 150 44 1 161 3 XCC2637 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UWM5 1.57e-45 150 44 1 161 3 XC_1480 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Xanthomonas campestris pv. campestris (strain 8004)
B0RQZ0 2.1e-45 149 44 1 161 3 xcc-b100_1525 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Xanthomonas campestris pv. campestris (strain B100)
C1D7M1 1.16e-44 147 45 0 158 3 LHK_01472 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Laribacter hongkongensis (strain HLHK9)
Q0A9G6 1.18e-44 147 44 0 158 3 Mlg_1172 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q9KPK1 2.07e-44 147 44 0 158 1 VC_2366 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q0VQ55 1.16e-42 142 44 1 159 3 ABO_1245 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q7NXI6 2.04e-41 139 44 0 159 3 CV_1640 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q7MNR7 6.75e-40 135 39 0 158 3 VV0648 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Vibrio vulnificus (strain YJ016)
Q8DEP0 6.75e-40 135 39 0 158 3 VV1_0547 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Vibrio vulnificus (strain CMCP6)
B2JIG2 5.74e-39 133 42 1 163 3 Bphy_1374 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
B6IPN3 1.23e-38 132 41 0 158 3 RC1_2349 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Rhodospirillum centenum (strain ATCC 51521 / SW)
Q63SX7 2.16e-38 132 42 1 163 3 BPSL2194 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Burkholderia pseudomallei (strain K96243)
A3NAY8 2.16e-38 132 42 1 163 3 BURPS668_2477 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Burkholderia pseudomallei (strain 668)
Q3JQZ3 2.16e-38 132 42 1 163 3 BURPS1710b_2618 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Burkholderia pseudomallei (strain 1710b)
A3NWR9 2.16e-38 132 42 1 163 3 BURPS1106A_2531 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Burkholderia pseudomallei (strain 1106a)
A1V5A8 2.16e-38 132 42 1 163 3 BMASAVP1_A2095 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Burkholderia mallei (strain SAVP1)
Q62J86 2.16e-38 132 42 1 163 3 BMA1593 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Burkholderia mallei (strain ATCC 23344)
A2SB35 2.16e-38 132 42 1 163 3 BMA10229_A3218 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Burkholderia mallei (strain NCTC 10229)
A3MKY3 2.16e-38 132 42 1 163 3 BMA10247_1368 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Burkholderia mallei (strain NCTC 10247)
Q5SIP7 2.33e-38 131 42 1 157 1 TTHA1322 4-hydroxy-4-methyl-2-oxoglutarate aldolase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q607E7 2.93e-38 131 43 1 160 3 MCA1813 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q87SD2 8.26e-38 130 36 0 158 3 VP0492 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q2SX33 3.16e-37 129 43 1 163 3 BTH_I1992 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q72J23 3.49e-37 129 41 1 157 3 TT_C0958 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
Q46ZV6 3.97e-37 128 41 1 164 3 Reut_A1963 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q8FQY0 4.84e-37 128 41 0 154 3 CE0987 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q6LUQ3 5.53e-37 128 38 0 154 3 PBPRA0549 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Photobacterium profundum (strain SS9)
Q5Z3P5 1.25e-36 127 43 0 152 3 NFA_1040 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Nocardia farcinica (strain IFM 10152)
Q9FH13 1.44e-36 127 40 1 161 1 At5g56260 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase 3 Arabidopsis thaliana
Q9M8R9 3.95e-36 126 40 1 156 2 At3g02770 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase 1 Arabidopsis thaliana
Q9FFE0 4.85e-36 125 40 1 156 1 At5g16450 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase 2 Arabidopsis thaliana
P9WGY3 7.34e-36 125 41 0 149 1 rraA Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGY2 7.34e-36 125 41 0 149 3 rraA Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U9I2 7.34e-36 125 41 0 149 3 MRA_3893 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AIV9 7.34e-36 125 41 0 149 3 JTY_3918 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KQI8 7.34e-36 125 41 0 149 3 BCG_3916 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P0A667 7.34e-36 125 41 0 149 3 BQ2027_MB3883 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q0K9J4 1.61e-35 124 39 1 164 3 H16_A2230 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
B8GM40 2.03e-35 124 40 0 149 3 Tgr7_2551 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
A3Q7S1 3.33e-35 123 41 0 149 3 Mjls_5435 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Mycobacterium sp. (strain JLS)
A0R664 9.66e-35 122 42 0 149 1 rraA Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
B2SXN2 2.18e-34 121 39 1 163 3 Bphyt_2492 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q13X79 2.49e-34 121 39 1 163 3 Bxeno_A2772 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Paraburkholderia xenovorans (strain LB400)
B3R2J3 2.53e-34 121 38 1 163 3 RALTA_A1769 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q1B1S4 2.77e-34 121 40 0 149 3 Mmcs_5056 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Mycobacterium sp. (strain MCS)
A1UNC5 2.77e-34 121 40 0 149 3 Mkms_5144 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Mycobacterium sp. (strain KMS)
A4T3Z0 3.69e-34 120 43 0 149 3 Mflv_1124 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Mycolicibacterium gilvum (strain PYR-GCK)
A9AHQ6 4.87e-34 120 38 1 163 3 Bmul_1223 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Burkholderia multivorans (strain ATCC 17616 / 249)
Q9CDD2 5.41e-34 120 41 0 149 3 ML0066 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Mycobacterium leprae (strain TN)
B8ZTT3 5.41e-34 120 41 0 149 3 MLBr00066 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Mycobacterium leprae (strain Br4923)
Q21X23 8.78e-34 120 38 2 165 3 Rfer_1955 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
A1TGZ7 5.62e-33 117 41 0 149 3 Mvan_5682 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q8XZP1 6.2e-33 118 39 1 163 3 RSc1354 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q8NRW6 1.12e-32 117 38 0 154 3 Cgl0925 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q4JVU3 2.48e-32 116 38 0 152 3 jk0900 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Corynebacterium jeikeium (strain K411)
A1WU91 2.78e-32 116 40 1 164 3 Hhal_0465 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Halorhodospira halophila (strain DSM 244 / SL1)
A4FBN0 5.46e-32 115 39 0 153 3 SACE_2149 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
Q8EE23 5.11e-31 113 38 0 152 3 SO_2567 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q9RW10 1.31e-30 112 40 2 155 3 DR_0859 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q734S7 1.9e-29 108 36 0 156 3 BCE_3327 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Bacillus cereus (strain ATCC 10987 / NRS 248)
Q638R8 3.88e-29 108 36 0 156 3 BCE33L3012 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Bacillus cereus (strain ZK / E33L)
Q745I2 6.15e-29 107 42 0 150 3 MAP_0181c Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0Q981 9.95e-29 107 42 0 149 3 MAV_0174 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Mycobacterium avium (strain 104)
Q81N49 4.03e-26 100 33 0 156 3 BA_3368 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Bacillus anthracis
Q58060 0.000182 43 23 3 156 4 MJ0644 Uncharacterized protein MJ0644 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q46DA4 0.000717 42 31 1 77 3 hpsA 3-hexulose-6-phosphate synthase Methanosarcina barkeri (strain Fusaro / DSM 804)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS15890
Feature type CDS
Gene rraA
Product ribonuclease E activity regulator RraA
Location 3527406 - 3527924 (strand: -1)
Length 519 (nucleotides) / 172 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1761
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF03737 Aldolase/RraA

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0684 Translation, ribosomal structure and biogenesis (J) J RNA degradosome component RraA (regulator of RNase E activity)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02553 regulator of ribonuclease activity A - -

Protein Sequence

MKYDTSELCDIYQEDINVVEPLFSNFGGRSSFGGQITTVKCFEDNGLLYDLLEENGKDRILLVDGGGSVRKALVDAELAQLAVLNEWEGIVVYGAVRQVDALSELDLGIQAMAAIPAGCPSEGIGDSDIRVNFGGVTFFSGDYLYADNTGIILSEEPLGLDDDDLDDDLLEE

Flanking regions ( +/- flanking 50bp)

CCTGTTAAGGGATATACTGGACTTTCCTGAGGCAACCTGACGTAAATCCTATGAAATATGATACTTCTGAACTCTGTGATATCTATCAAGAAGATATCAATGTCGTAGAACCGCTTTTCTCAAACTTTGGTGGTCGTAGCTCTTTTGGTGGACAAATTACCACTGTCAAATGTTTTGAAGATAATGGTCTGCTTTATGACTTACTAGAAGAAAACGGTAAAGATCGTATTCTATTAGTTGATGGCGGAGGCTCTGTCCGCAAAGCGCTAGTCGACGCTGAATTGGCGCAACTGGCGGTACTCAACGAATGGGAAGGTATTGTTGTTTATGGTGCAGTACGCCAAGTGGACGCTTTATCTGAGCTTGATTTAGGCATTCAAGCGATGGCTGCCATTCCTGCAGGTTGCCCAAGTGAAGGCATCGGCGACAGTGATATCCGCGTAAACTTTGGTGGTGTTACTTTCTTCTCCGGTGATTATCTTTATGCTGATAATACTGGCATTATCTTATCTGAAGAGCCTTTAGGCTTAGATGATGACGATTTAGATGATGATTTATTAGAAGAATAATAGACCATTCTCTTATTAACAAAGATAACGCATAAAGCGACAAAAGCCAC