Homologs in group_1800

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_12260 FBDBKF_12260 91.0 Morganella morganii S1 rraA ribonuclease E activity regulator RraA
EHELCC_14045 EHELCC_14045 91.0 Morganella morganii S2 rraA ribonuclease E activity regulator RraA
NLDBIP_15140 NLDBIP_15140 91.0 Morganella morganii S4 rraA ribonuclease E activity regulator RraA
LHKJJB_15470 LHKJJB_15470 91.0 Morganella morganii S3 rraA ribonuclease E activity regulator RraA
HKOGLL_14590 HKOGLL_14590 91.0 Morganella morganii S5 rraA ribonuclease E activity regulator RraA
PMI_RS15890 PMI_RS15890 83.1 Proteus mirabilis HI4320 rraA ribonuclease E activity regulator RraA

Distribution of the homologs in the orthogroup group_1800

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1800

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A8GL98 2.83e-94 273 85 0 157 3 rraA Regulator of ribonuclease activity A Serratia proteamaculans (strain 568)
B4F169 3.13e-94 274 86 0 157 3 rraA Regulator of ribonuclease activity A Proteus mirabilis (strain HI4320)
A7ML69 3.84e-94 273 84 0 158 3 rraA Regulator of ribonuclease activity A Cronobacter sakazakii (strain ATCC BAA-894)
Q3YV49 6.5e-94 273 84 0 158 3 rraA Regulator of ribonuclease activity A Shigella sonnei (strain Ss046)
P0A8R3 6.5e-94 273 84 0 158 3 rraA Regulator of ribonuclease activity A Shigella flexneri
Q31U61 6.5e-94 273 84 0 158 3 rraA Regulator of ribonuclease activity A Shigella boydii serotype 4 (strain Sb227)
B2TWC5 6.5e-94 273 84 0 158 3 rraA Regulator of ribonuclease activity A Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1R3Y9 6.5e-94 273 84 0 158 3 rraA Regulator of ribonuclease activity A Escherichia coli (strain UTI89 / UPEC)
B1LNN4 6.5e-94 273 84 0 158 3 rraA Regulator of ribonuclease activity A Escherichia coli (strain SMS-3-5 / SECEC)
B6I4S2 6.5e-94 273 84 0 158 3 rraA Regulator of ribonuclease activity A Escherichia coli (strain SE11)
B7NFM8 6.5e-94 273 84 0 158 3 rraA Regulator of ribonuclease activity A Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A8R0 6.5e-94 273 84 0 158 1 rraA Regulator of ribonuclease activity A Escherichia coli (strain K12)
B1IVF0 6.5e-94 273 84 0 158 3 rraA Regulator of ribonuclease activity A Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A8R1 6.5e-94 273 84 0 158 3 rraA Regulator of ribonuclease activity A Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TAD5 6.5e-94 273 84 0 158 3 rraA Regulator of ribonuclease activity A Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A8A735 6.5e-94 273 84 0 158 3 rraA Regulator of ribonuclease activity A Escherichia coli O9:H4 (strain HS)
B1XB95 6.5e-94 273 84 0 158 3 rraA Regulator of ribonuclease activity A Escherichia coli (strain K12 / DH10B)
C5A096 6.5e-94 273 84 0 158 3 rraA Regulator of ribonuclease activity A Escherichia coli (strain K12 / MC4100 / BW2952)
B7M6Y0 6.5e-94 273 84 0 158 3 rraA Regulator of ribonuclease activity A Escherichia coli O8 (strain IAI1)
B7MR18 6.5e-94 273 84 0 158 3 rraA Regulator of ribonuclease activity A Escherichia coli O81 (strain ED1a)
B7NU76 6.5e-94 273 84 0 158 3 rraA Regulator of ribonuclease activity A Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YZ69 6.5e-94 273 84 0 158 3 rraA Regulator of ribonuclease activity A Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A8R2 6.5e-94 273 84 0 158 3 rraA Regulator of ribonuclease activity A Escherichia coli O157:H7
B7LA26 6.5e-94 273 84 0 158 3 rraA Regulator of ribonuclease activity A Escherichia coli (strain 55989 / EAEC)
B7MI61 6.5e-94 273 84 0 158 3 rraA Regulator of ribonuclease activity A Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UNP9 6.5e-94 273 84 0 158 3 rraA Regulator of ribonuclease activity A Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZUE4 6.5e-94 273 84 0 158 3 rraA Regulator of ribonuclease activity A Escherichia coli O139:H28 (strain E24377A / ETEC)
A8AKZ4 7.75e-94 272 84 0 158 3 rraA Regulator of ribonuclease activity A Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q6CZ89 8.94e-94 272 86 0 157 3 rraA Regulator of ribonuclease activity A Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P67651 1.74e-93 271 84 0 158 3 rraA Regulator of ribonuclease activity A Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P67652 1.74e-93 271 84 0 158 3 rraA Regulator of ribonuclease activity A Salmonella typhi
B4TPV0 1.74e-93 271 84 0 158 3 rraA Regulator of ribonuclease activity A Salmonella schwarzengrund (strain CVM19633)
B5BJK6 1.74e-93 271 84 0 158 3 rraA Regulator of ribonuclease activity A Salmonella paratyphi A (strain AKU_12601)
C0Q439 1.74e-93 271 84 0 158 3 rraA Regulator of ribonuclease activity A Salmonella paratyphi C (strain RKS4594)
Q5PIS0 1.74e-93 271 84 0 158 3 rraA Regulator of ribonuclease activity A Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T0T6 1.74e-93 271 84 0 158 3 rraA Regulator of ribonuclease activity A Salmonella newport (strain SL254)
B4TCM6 1.74e-93 271 84 0 158 3 rraA Regulator of ribonuclease activity A Salmonella heidelberg (strain SL476)
B5RF82 1.74e-93 271 84 0 158 3 rraA Regulator of ribonuclease activity A Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QXL8 1.74e-93 271 84 0 158 3 rraA Regulator of ribonuclease activity A Salmonella enteritidis PT4 (strain P125109)
B5FPT8 1.74e-93 271 84 0 158 3 rraA Regulator of ribonuclease activity A Salmonella dublin (strain CT_02021853)
B5F0S0 1.74e-93 271 84 0 158 3 rraA Regulator of ribonuclease activity A Salmonella agona (strain SL483)
A9MI36 1.78e-93 271 84 0 158 3 rraA Regulator of ribonuclease activity A Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
C6DHM4 1.95e-93 271 85 0 157 3 rraA Regulator of ribonuclease activity A Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B7LUS5 2.73e-93 271 83 0 158 3 rraA Regulator of ribonuclease activity A Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q0SY60 2.89e-93 271 83 0 158 3 rraA Regulator of ribonuclease activity A Shigella flexneri serotype 5b (strain 8401)
Q57HC8 3.33e-93 271 83 0 158 3 rraA Regulator of ribonuclease activity A Salmonella choleraesuis (strain SC-B67)
Q32AA2 3.84e-93 271 83 0 158 3 rraA Regulator of ribonuclease activity A Shigella dysenteriae serotype 1 (strain Sd197)
A6TGB9 5.16e-93 270 84 0 158 3 rraA Regulator of ribonuclease activity A Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XZ39 5.16e-93 270 84 0 158 3 rraA Regulator of ribonuclease activity A Klebsiella pneumoniae (strain 342)
A4WG69 1.43e-92 269 84 0 158 3 rraA Regulator of ribonuclease activity A Enterobacter sp. (strain 638)
Q7MYB9 1.45e-92 270 80 1 168 3 rraA Regulator of ribonuclease activity A Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B2VES2 1.95e-92 269 84 0 158 3 rraA Regulator of ribonuclease activity A Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
B1JQ78 3.05e-92 268 83 0 158 3 rraA Regulator of ribonuclease activity A Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66G87 3.05e-92 268 83 0 158 3 rraA Regulator of ribonuclease activity A Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TS86 3.05e-92 268 83 0 158 3 rraA Regulator of ribonuclease activity A Yersinia pestis (strain Pestoides F)
Q1CD53 3.05e-92 268 83 0 158 3 rraA Regulator of ribonuclease activity A Yersinia pestis bv. Antiqua (strain Nepal516)
A9R6C5 3.05e-92 268 83 0 158 3 rraA Regulator of ribonuclease activity A Yersinia pestis bv. Antiqua (strain Angola)
Q8ZJJ7 3.05e-92 268 83 0 158 3 rraA Regulator of ribonuclease activity A Yersinia pestis
B2JZC3 3.05e-92 268 83 0 158 3 rraA Regulator of ribonuclease activity A Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1CBF0 3.05e-92 268 83 0 158 3 rraA Regulator of ribonuclease activity A Yersinia pestis bv. Antiqua (strain Antiqua)
A7FCY2 3.05e-92 268 83 0 158 3 rraA Regulator of ribonuclease activity A Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
C5BB79 3.33e-92 268 84 0 158 3 rraA Regulator of ribonuclease activity A Edwardsiella ictaluri (strain 93-146)
A1JI06 5.33e-92 268 83 0 158 3 rraA Regulator of ribonuclease activity A Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q2NQY0 2.16e-85 251 84 0 157 3 rraA Regulator of ribonuclease activity A Sodalis glossinidius (strain morsitans)
Q9KNQ9 9.07e-78 232 70 0 158 3 rraA Regulator of ribonuclease activity A Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9CLP9 6.92e-76 227 68 1 166 3 rraA Regulator of ribonuclease activity A Pasteurella multocida (strain Pm70)
Q8E9R9 3.27e-75 225 67 0 157 3 rraA Regulator of ribonuclease activity A Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q12S21 6.44e-75 224 66 0 157 3 rraA Regulator of ribonuclease activity A Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q4QN38 4.43e-74 223 69 0 157 3 rraA Regulator of ribonuclease activity A Haemophilus influenzae (strain 86-028NP)
P44738 5.57e-74 222 69 0 157 3 rraA Regulator of ribonuclease activity A Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UH15 5.57e-74 222 69 0 157 3 rraA Regulator of ribonuclease activity A Haemophilus influenzae (strain PittGG)
A5U9Y3 5.57e-74 222 69 0 157 3 rraA Regulator of ribonuclease activity A Haemophilus influenzae (strain PittEE)
B0UV42 1.41e-73 221 66 0 161 3 rraA Regulator of ribonuclease activity A Histophilus somni (strain 2336)
Q0I1S4 1.69e-73 221 66 0 161 3 rraA Regulator of ribonuclease activity A Histophilus somni (strain 129Pt)
Q6LVI5 1.33e-72 219 64 0 157 3 rraA Regulator of ribonuclease activity A Photobacterium profundum (strain SS9)
Q8DCP6 1.4e-72 219 65 0 158 3 rraA Regulator of ribonuclease activity A Vibrio vulnificus (strain CMCP6)
P59885 3.77e-72 218 69 0 160 3 rraA Regulator of ribonuclease activity A Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q7MH54 5.66e-72 218 65 0 158 3 rraA Regulator of ribonuclease activity A Vibrio vulnificus (strain YJ016)
Q87T23 1.14e-71 217 64 0 157 3 rraA Regulator of ribonuclease activity A Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A8G0S5 3.88e-71 215 64 0 157 3 rraA Regulator of ribonuclease activity A Shewanella sediminis (strain HAW-EB3)
A6VLP4 7.01e-71 214 64 0 164 3 rraA Regulator of ribonuclease activity A Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
B0BTI0 1.7e-70 213 70 0 152 3 rraA Regulator of ribonuclease activity A Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A3N3J5 1.7e-70 213 70 0 152 3 rraA Regulator of ribonuclease activity A Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B8F7G7 1.78e-70 213 66 0 163 3 rraA Regulator of ribonuclease activity A Glaesserella parasuis serovar 5 (strain SH0165)
B3H2X0 8.04e-70 212 69 0 152 3 rraA Regulator of ribonuclease activity A Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
Q65RG4 1.03e-68 209 66 0 152 3 rraA Regulator of ribonuclease activity A Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q15NG9 7.23e-66 202 58 0 157 3 rraA Regulator of ribonuclease activity A Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
B4S2E4 1.08e-64 199 60 0 157 3 rraA Regulator of ribonuclease activity A Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
A1SZR8 4.03e-64 197 60 0 158 3 rraA Regulator of ribonuclease activity A Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
C4LBS7 3.16e-63 195 61 0 157 3 rraA Regulator of ribonuclease activity A Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q5QV38 3.74e-62 192 59 0 157 3 rraA Regulator of ribonuclease activity A Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q3IJD2 6.13e-61 189 59 0 152 3 rraA Regulator of ribonuclease activity A Pseudoalteromonas translucida (strain TAC 125)
C1DHC2 2.18e-60 188 55 0 160 3 Avin_23290 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q47VZ9 4.85e-59 184 56 0 157 3 rraA Regulator of ribonuclease activity A Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q883Q6 5.25e-59 184 54 0 160 3 PSPTO_2294 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q4KFJ3 2.08e-58 183 51 0 162 3 PFL_1871 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q1ICM4 3.08e-58 182 53 0 160 3 PSEEN1744 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Pseudomonas entomophila (strain L48)
Q88L51 3.11e-58 182 53 0 160 3 PP_2084 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5W6M0 3.47e-58 182 53 0 160 3 Pput_3656 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
B0KG79 5.37e-58 182 53 0 160 3 PputGB1_1595 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Pseudomonas putida (strain GB-1)
Q9I2W7 7.22e-58 181 53 0 160 1 PA1772 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02KR3 7.22e-58 181 53 0 160 1 PA14_41640 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Pseudomonas aeruginosa (strain UCBPP-PA14)
B7VBA7 7.22e-58 181 53 0 160 3 PLES_35571 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Pseudomonas aeruginosa (strain LESB58)
Q9S4U0 2.99e-57 180 52 0 160 3 None Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Pseudomonas fluorescens
A4XU32 5.88e-57 179 53 0 160 3 Pmen_2087 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Pseudomonas mendocina (strain ymp)
A4VL60 8.81e-57 179 52 0 160 3 PST_2040 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Stutzerimonas stutzeri (strain A1501)
C3K0T6 2.28e-56 177 50 0 162 3 PFLU_4617 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Pseudomonas fluorescens (strain SBW25)
A6V753 3.41e-56 177 51 0 159 3 PSPA7_3534 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Pseudomonas aeruginosa (strain PA7)
Q3KFE1 3.72e-56 177 50 0 162 3 Pfl01_1772 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Pseudomonas fluorescens (strain Pf0-1)
Q4ZUN7 5.9e-56 176 51 0 160 3 Psyr_2092 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Pseudomonas syringae pv. syringae (strain B728a)
Q48JZ3 1.96e-55 175 51 1 162 3 PSPPH_2063 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
B1J596 3.13e-55 175 51 0 160 3 PputW619_1602 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Pseudomonas putida (strain W619)
Q2SK70 8.83e-54 171 48 0 161 3 HCH_02125 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Hahella chejuensis (strain KCTC 2396)
Q47BF5 3.37e-48 157 46 1 161 3 Daro_3096 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Dechloromonas aromatica (strain RCB)
A6VX14 2.86e-46 152 45 0 156 3 Mmwyl1_2071 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Marinomonas sp. (strain MWYL1)
Q0A9G6 6.16e-45 149 45 0 153 3 Mlg_1172 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
C1D7M1 9.78e-45 148 45 0 156 3 LHK_01472 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Laribacter hongkongensis (strain HLHK9)
Q5P203 7.02e-44 145 42 0 156 3 AZOSEA25360 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q3BRB4 7.06e-44 146 43 1 157 3 XCV2968 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PIT8 1.22e-43 145 42 1 157 3 XAC2807 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Xanthomonas axonopodis pv. citri (strain 306)
B0RQZ0 1.82e-43 145 43 1 158 3 xcc-b100_1525 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Xanthomonas campestris pv. campestris (strain B100)
Q8P7H4 1.86e-43 145 43 1 158 3 XCC2637 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UWM5 1.86e-43 145 43 1 158 3 XC_1480 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Xanthomonas campestris pv. campestris (strain 8004)
Q9KPK1 7.75e-43 143 41 0 156 1 VC_2366 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
B2SSI8 1.35e-42 143 42 1 157 3 PXO_04832 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P5H9 1.35e-42 143 42 1 157 3 XOO1443 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q6FCF4 1.97e-42 142 46 2 162 3 ACIAD1391 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q0VQ55 7.89e-42 140 46 1 158 3 ABO_1245 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q63SX7 4.49e-40 136 43 1 158 3 BPSL2194 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Burkholderia pseudomallei (strain K96243)
A3NAY8 4.49e-40 136 43 1 158 3 BURPS668_2477 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Burkholderia pseudomallei (strain 668)
Q3JQZ3 4.49e-40 136 43 1 158 3 BURPS1710b_2618 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Burkholderia pseudomallei (strain 1710b)
A3NWR9 4.49e-40 136 43 1 158 3 BURPS1106A_2531 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Burkholderia pseudomallei (strain 1106a)
A1V5A8 4.49e-40 136 43 1 158 3 BMASAVP1_A2095 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Burkholderia mallei (strain SAVP1)
Q62J86 4.49e-40 136 43 1 158 3 BMA1593 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Burkholderia mallei (strain ATCC 23344)
A2SB35 4.49e-40 136 43 1 158 3 BMA10229_A3218 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Burkholderia mallei (strain NCTC 10229)
A3MKY3 4.49e-40 136 43 1 158 3 BMA10247_1368 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Burkholderia mallei (strain NCTC 10247)
Q7NXI6 5.1e-40 136 42 0 157 3 CV_1640 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q5SIP7 2.04e-39 134 43 1 153 1 TTHA1322 4-hydroxy-4-methyl-2-oxoglutarate aldolase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q2SX33 2.73e-39 134 44 1 163 3 BTH_I1992 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
B2JIG2 3.05e-39 134 41 1 161 3 Bphy_1374 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q87SD2 4.98e-39 133 37 0 155 3 VP0492 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q9M8R9 2.07e-38 132 40 1 160 2 At3g02770 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase 1 Arabidopsis thaliana
Q9FFE0 3.2e-38 132 40 1 160 1 At5g16450 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase 2 Arabidopsis thaliana
Q72J23 3.48e-38 131 42 1 153 3 TT_C0958 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
Q607E7 4.13e-38 131 43 1 158 3 MCA1813 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q7MNR7 4.43e-38 131 38 0 150 3 VV0648 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Vibrio vulnificus (strain YJ016)
Q8DEP0 4.43e-38 131 38 0 150 3 VV1_0547 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Vibrio vulnificus (strain CMCP6)
B6IPN3 6.2e-38 130 42 0 150 3 RC1_2349 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Rhodospirillum centenum (strain ATCC 51521 / SW)
B2SXN2 9.97e-38 130 41 1 163 3 Bphyt_2492 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q6LUQ3 1.08e-37 130 39 0 153 3 PBPRA0549 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Photobacterium profundum (strain SS9)
Q8FQY0 1.25e-37 130 42 0 157 3 CE0987 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
A9AHQ6 3.59e-37 129 38 1 162 3 Bmul_1223 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Burkholderia multivorans (strain ATCC 17616 / 249)
Q9FH13 5.62e-37 128 41 1 162 1 At5g56260 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase 3 Arabidopsis thaliana
Q13X79 5.72e-37 128 40 1 163 3 Bxeno_A2772 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Paraburkholderia xenovorans (strain LB400)
Q21X23 6.24e-37 129 39 2 167 3 Rfer_1955 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
A3Q7S1 7e-37 128 43 0 149 3 Mjls_5435 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Mycobacterium sp. (strain JLS)
Q5Z3P5 7.01e-37 128 43 0 149 3 NFA_1040 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Nocardia farcinica (strain IFM 10152)
Q0K9J4 1.02e-36 128 41 1 156 3 H16_A2230 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
B3R2J3 1.48e-36 127 41 1 156 3 RALTA_A1769 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q46ZV6 4.99e-36 126 40 1 161 3 Reut_A1963 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q1B1S4 5.75e-36 125 42 0 149 3 Mmcs_5056 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Mycobacterium sp. (strain MCS)
A1UNC5 5.75e-36 125 42 0 149 3 Mkms_5144 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Mycobacterium sp. (strain KMS)
Q9CDD2 7.52e-36 125 42 0 149 3 ML0066 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Mycobacterium leprae (strain TN)
B8ZTT3 7.52e-36 125 42 0 149 3 MLBr00066 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Mycobacterium leprae (strain Br4923)
B8GM40 1.29e-35 125 40 0 149 3 Tgr7_2551 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
A0R664 1.56e-35 124 41 0 156 1 rraA Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P9WGY3 4.45e-35 123 42 0 149 1 rraA Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGY2 4.45e-35 123 42 0 149 3 rraA Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U9I2 4.45e-35 123 42 0 149 3 MRA_3893 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AIV9 4.45e-35 123 42 0 149 3 JTY_3918 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KQI8 4.45e-35 123 42 0 149 3 BCG_3916 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P0A667 4.45e-35 123 42 0 149 3 BQ2027_MB3883 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q8NRW6 1.02e-34 122 39 0 154 3 Cgl0925 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4T3Z0 1.32e-34 122 44 0 149 3 Mflv_1124 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Mycolicibacterium gilvum (strain PYR-GCK)
Q8XZP1 2.53e-34 122 40 1 155 3 RSc1354 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q4JVU3 6.3e-34 120 40 0 151 3 jk0900 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Corynebacterium jeikeium (strain K411)
Q9RW10 2.51e-33 119 39 1 154 3 DR_0859 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
A1TGZ7 3.4e-33 119 42 0 149 3 Mvan_5682 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
A4FBN0 1.04e-31 115 40 0 151 3 SACE_2149 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
A1WU91 1.89e-31 114 41 1 158 3 Hhal_0465 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Halorhodospira halophila (strain DSM 244 / SL1)
Q8EE23 3.74e-30 111 36 0 154 3 SO_2567 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q734S7 9.3e-30 110 37 0 156 3 BCE_3327 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Bacillus cereus (strain ATCC 10987 / NRS 248)
Q638R8 3.66e-28 105 35 0 156 3 BCE33L3012 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Bacillus cereus (strain ZK / E33L)
Q81N49 9.97e-28 104 35 0 156 3 BA_3368 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Bacillus anthracis
Q745I2 1.01e-26 102 41 0 150 3 MAP_0181c Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0Q981 1.34e-26 102 41 0 149 3 MAV_0174 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Mycobacterium avium (strain 104)
Q58060 1.99e-05 46 25 2 154 4 MJ0644 Uncharacterized protein MJ0644 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q9KBI9 0.000117 44 26 1 124 3 BH1938 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q46DA4 0.00028 43 29 0 74 3 hpsA 3-hexulose-6-phosphate synthase Methanosarcina barkeri (strain Fusaro / DSM 804)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS17090
Feature type CDS
Gene rraA
Product ribonuclease E activity regulator RraA
Location 46792 - 47340 (strand: 1)
Length 549 (nucleotides) / 182 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000007
Length 196482 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1800
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF03737 Aldolase/RraA

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0684 Translation, ribosomal structure and biogenesis (J) J RNA degradosome component RraA (regulator of RNase E activity)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02553 regulator of ribonuclease activity A - -

Protein Sequence

MKNDTFDTSELCDIYQENVNVVEPLFSNFGGCSSFGGQITTVKCFEDNGLLFDLLEENGEGRILLIDGGGSVRRALIDAELAFLAVQNGWEGIVLYGAVRQVDDLSELDIGIQAMAAIPAGCASEGIGESDIRVNFGGVTFFSGDYLYADNTGIILSDVPLDAPEDDEENDDEDGEDELTAN

Flanking regions ( +/- flanking 50bp)

AGGAAGGGGCTATACTGATCCTATCCGGCAGCAACCAGACATAAAATCCTATGAAAAATGATACCTTCGACACCTCCGAGCTTTGTGACATTTACCAGGAAAATGTGAATGTCGTTGAACCCCTGTTTTCCAACTTCGGGGGATGTTCATCATTCGGGGGACAAATTACCACCGTTAAGTGTTTCGAAGATAACGGACTGCTCTTTGATCTCCTGGAAGAAAACGGAGAAGGACGCATCCTGCTTATCGACGGAGGCGGTTCTGTCCGTCGCGCATTGATTGATGCAGAGCTGGCGTTTCTCGCAGTACAGAACGGATGGGAAGGAATTGTGCTCTATGGTGCTGTCCGTCAGGTTGATGACCTGTCTGAGCTGGATATCGGTATCCAGGCAATGGCGGCAATCCCGGCCGGATGTGCTTCTGAAGGCATCGGCGAGAGTGATATCCGCGTCAATTTCGGTGGCGTGACATTCTTCTCCGGCGATTATCTGTATGCAGATAATACCGGGATCATCTTATCTGACGTCCCGCTGGACGCACCGGAAGATGATGAAGAAAACGATGATGAAGACGGTGAAGATGAACTTACCGCAAATTAATTAACATTCGCGGAACACAAACACCAAAAAGGGCGGATATTCCGCCCTTT