Homologs in group_1800

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_12260 FBDBKF_12260 100.0 Morganella morganii S1 rraA ribonuclease E activity regulator RraA
NLDBIP_15140 NLDBIP_15140 100.0 Morganella morganii S4 rraA ribonuclease E activity regulator RraA
LHKJJB_15470 LHKJJB_15470 100.0 Morganella morganii S3 rraA ribonuclease E activity regulator RraA
HKOGLL_14590 HKOGLL_14590 100.0 Morganella morganii S5 rraA ribonuclease E activity regulator RraA
F4V73_RS17090 F4V73_RS17090 91.0 Morganella psychrotolerans rraA ribonuclease E activity regulator RraA
PMI_RS15890 PMI_RS15890 85.3 Proteus mirabilis HI4320 rraA ribonuclease E activity regulator RraA

Distribution of the homologs in the orthogroup group_1800

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1800

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4F169 1.26e-93 272 86 0 157 3 rraA Regulator of ribonuclease activity A Proteus mirabilis (strain HI4320)
Q7MYB9 6.28e-93 270 80 1 170 3 rraA Regulator of ribonuclease activity A Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q6CZ89 1.74e-92 269 84 0 157 3 rraA Regulator of ribonuclease activity A Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C6DHM4 2.29e-92 268 84 0 157 3 rraA Regulator of ribonuclease activity A Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A7ML69 1.25e-91 266 81 0 159 3 rraA Regulator of ribonuclease activity A Cronobacter sakazakii (strain ATCC BAA-894)
A8GL98 1.56e-91 266 83 0 156 3 rraA Regulator of ribonuclease activity A Serratia proteamaculans (strain 568)
A8AKZ4 6.14e-91 265 81 0 159 3 rraA Regulator of ribonuclease activity A Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q3YV49 6.28e-91 265 81 0 159 3 rraA Regulator of ribonuclease activity A Shigella sonnei (strain Ss046)
P0A8R3 6.28e-91 265 81 0 159 3 rraA Regulator of ribonuclease activity A Shigella flexneri
Q31U61 6.28e-91 265 81 0 159 3 rraA Regulator of ribonuclease activity A Shigella boydii serotype 4 (strain Sb227)
B2TWC5 6.28e-91 265 81 0 159 3 rraA Regulator of ribonuclease activity A Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1R3Y9 6.28e-91 265 81 0 159 3 rraA Regulator of ribonuclease activity A Escherichia coli (strain UTI89 / UPEC)
B1LNN4 6.28e-91 265 81 0 159 3 rraA Regulator of ribonuclease activity A Escherichia coli (strain SMS-3-5 / SECEC)
B6I4S2 6.28e-91 265 81 0 159 3 rraA Regulator of ribonuclease activity A Escherichia coli (strain SE11)
B7NFM8 6.28e-91 265 81 0 159 3 rraA Regulator of ribonuclease activity A Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A8R0 6.28e-91 265 81 0 159 1 rraA Regulator of ribonuclease activity A Escherichia coli (strain K12)
B1IVF0 6.28e-91 265 81 0 159 3 rraA Regulator of ribonuclease activity A Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A8R1 6.28e-91 265 81 0 159 3 rraA Regulator of ribonuclease activity A Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TAD5 6.28e-91 265 81 0 159 3 rraA Regulator of ribonuclease activity A Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A8A735 6.28e-91 265 81 0 159 3 rraA Regulator of ribonuclease activity A Escherichia coli O9:H4 (strain HS)
B1XB95 6.28e-91 265 81 0 159 3 rraA Regulator of ribonuclease activity A Escherichia coli (strain K12 / DH10B)
C5A096 6.28e-91 265 81 0 159 3 rraA Regulator of ribonuclease activity A Escherichia coli (strain K12 / MC4100 / BW2952)
B7M6Y0 6.28e-91 265 81 0 159 3 rraA Regulator of ribonuclease activity A Escherichia coli O8 (strain IAI1)
B7MR18 6.28e-91 265 81 0 159 3 rraA Regulator of ribonuclease activity A Escherichia coli O81 (strain ED1a)
B7NU76 6.28e-91 265 81 0 159 3 rraA Regulator of ribonuclease activity A Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YZ69 6.28e-91 265 81 0 159 3 rraA Regulator of ribonuclease activity A Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A8R2 6.28e-91 265 81 0 159 3 rraA Regulator of ribonuclease activity A Escherichia coli O157:H7
B7LA26 6.28e-91 265 81 0 159 3 rraA Regulator of ribonuclease activity A Escherichia coli (strain 55989 / EAEC)
B7MI61 6.28e-91 265 81 0 159 3 rraA Regulator of ribonuclease activity A Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UNP9 6.28e-91 265 81 0 159 3 rraA Regulator of ribonuclease activity A Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZUE4 6.28e-91 265 81 0 159 3 rraA Regulator of ribonuclease activity A Escherichia coli O139:H28 (strain E24377A / ETEC)
A9MI36 6.42e-91 265 81 0 159 3 rraA Regulator of ribonuclease activity A Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
P67651 1.28e-90 264 81 0 159 3 rraA Regulator of ribonuclease activity A Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P67652 1.28e-90 264 81 0 159 3 rraA Regulator of ribonuclease activity A Salmonella typhi
B4TPV0 1.28e-90 264 81 0 159 3 rraA Regulator of ribonuclease activity A Salmonella schwarzengrund (strain CVM19633)
B5BJK6 1.28e-90 264 81 0 159 3 rraA Regulator of ribonuclease activity A Salmonella paratyphi A (strain AKU_12601)
C0Q439 1.28e-90 264 81 0 159 3 rraA Regulator of ribonuclease activity A Salmonella paratyphi C (strain RKS4594)
Q5PIS0 1.28e-90 264 81 0 159 3 rraA Regulator of ribonuclease activity A Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T0T6 1.28e-90 264 81 0 159 3 rraA Regulator of ribonuclease activity A Salmonella newport (strain SL254)
B4TCM6 1.28e-90 264 81 0 159 3 rraA Regulator of ribonuclease activity A Salmonella heidelberg (strain SL476)
B5RF82 1.28e-90 264 81 0 159 3 rraA Regulator of ribonuclease activity A Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QXL8 1.28e-90 264 81 0 159 3 rraA Regulator of ribonuclease activity A Salmonella enteritidis PT4 (strain P125109)
B5FPT8 1.28e-90 264 81 0 159 3 rraA Regulator of ribonuclease activity A Salmonella dublin (strain CT_02021853)
B5F0S0 1.28e-90 264 81 0 159 3 rraA Regulator of ribonuclease activity A Salmonella agona (strain SL483)
Q57HC8 2.67e-90 263 80 0 159 3 rraA Regulator of ribonuclease activity A Salmonella choleraesuis (strain SC-B67)
B7LUS5 2.85e-90 263 80 0 159 3 rraA Regulator of ribonuclease activity A Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q0SY60 3.11e-90 263 80 0 159 3 rraA Regulator of ribonuclease activity A Shigella flexneri serotype 5b (strain 8401)
Q32AA2 3.88e-90 263 80 0 159 3 rraA Regulator of ribonuclease activity A Shigella dysenteriae serotype 1 (strain Sd197)
B1JQ78 6.56e-90 262 80 0 159 3 rraA Regulator of ribonuclease activity A Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66G87 6.56e-90 262 80 0 159 3 rraA Regulator of ribonuclease activity A Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TS86 6.56e-90 262 80 0 159 3 rraA Regulator of ribonuclease activity A Yersinia pestis (strain Pestoides F)
Q1CD53 6.56e-90 262 80 0 159 3 rraA Regulator of ribonuclease activity A Yersinia pestis bv. Antiqua (strain Nepal516)
A9R6C5 6.56e-90 262 80 0 159 3 rraA Regulator of ribonuclease activity A Yersinia pestis bv. Antiqua (strain Angola)
Q8ZJJ7 6.56e-90 262 80 0 159 3 rraA Regulator of ribonuclease activity A Yersinia pestis
B2JZC3 6.56e-90 262 80 0 159 3 rraA Regulator of ribonuclease activity A Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1CBF0 6.56e-90 262 80 0 159 3 rraA Regulator of ribonuclease activity A Yersinia pestis bv. Antiqua (strain Antiqua)
A7FCY2 6.56e-90 262 80 0 159 3 rraA Regulator of ribonuclease activity A Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
C5BB79 7.65e-90 262 81 0 159 3 rraA Regulator of ribonuclease activity A Edwardsiella ictaluri (strain 93-146)
A4WG69 1.23e-89 261 80 0 159 3 rraA Regulator of ribonuclease activity A Enterobacter sp. (strain 638)
B2VES2 1.28e-89 261 81 0 159 3 rraA Regulator of ribonuclease activity A Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A6TGB9 1.67e-89 261 79 0 159 3 rraA Regulator of ribonuclease activity A Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XZ39 1.67e-89 261 79 0 159 3 rraA Regulator of ribonuclease activity A Klebsiella pneumoniae (strain 342)
A1JI06 2.42e-89 261 81 0 157 3 rraA Regulator of ribonuclease activity A Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q2NQY0 2.23e-83 246 81 0 158 3 rraA Regulator of ribonuclease activity A Sodalis glossinidius (strain morsitans)
Q9KNQ9 1.08e-78 234 71 0 157 3 rraA Regulator of ribonuclease activity A Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9CLP9 2.63e-77 231 69 0 162 3 rraA Regulator of ribonuclease activity A Pasteurella multocida (strain Pm70)
Q87T23 7.37e-74 222 63 0 168 3 rraA Regulator of ribonuclease activity A Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q8E9R9 1.14e-73 221 65 0 158 3 rraA Regulator of ribonuclease activity A Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q8DCP6 1.42e-73 221 67 0 157 3 rraA Regulator of ribonuclease activity A Vibrio vulnificus (strain CMCP6)
Q12S21 5.22e-73 219 64 0 158 3 rraA Regulator of ribonuclease activity A Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q7MH54 6.51e-73 219 66 0 157 3 rraA Regulator of ribonuclease activity A Vibrio vulnificus (strain YJ016)
Q4QN38 1.96e-72 218 66 0 157 3 rraA Regulator of ribonuclease activity A Haemophilus influenzae (strain 86-028NP)
B0UV42 2.24e-72 218 64 0 159 3 rraA Regulator of ribonuclease activity A Histophilus somni (strain 2336)
P44738 2.47e-72 218 66 0 157 3 rraA Regulator of ribonuclease activity A Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UH15 2.47e-72 218 66 0 157 3 rraA Regulator of ribonuclease activity A Haemophilus influenzae (strain PittGG)
A5U9Y3 2.47e-72 218 66 0 157 3 rraA Regulator of ribonuclease activity A Haemophilus influenzae (strain PittEE)
Q0I1S4 2.82e-72 218 64 0 159 3 rraA Regulator of ribonuclease activity A Histophilus somni (strain 129Pt)
P59885 3.59e-72 218 68 0 160 3 rraA Regulator of ribonuclease activity A Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q6LVI5 1.5e-71 216 64 0 156 3 rraA Regulator of ribonuclease activity A Photobacterium profundum (strain SS9)
B0BTI0 4.4e-71 215 69 0 152 3 rraA Regulator of ribonuclease activity A Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A3N3J5 4.4e-71 215 69 0 152 3 rraA Regulator of ribonuclease activity A Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B8F7G7 8.87e-71 214 67 0 161 3 rraA Regulator of ribonuclease activity A Glaesserella parasuis serovar 5 (strain SH0165)
B3H2X0 1.99e-70 213 68 0 152 3 rraA Regulator of ribonuclease activity A Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A6VLP4 5e-70 212 62 0 162 3 rraA Regulator of ribonuclease activity A Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q65RG4 1.34e-69 211 66 0 151 3 rraA Regulator of ribonuclease activity A Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A8G0S5 2.42e-69 210 62 0 158 3 rraA Regulator of ribonuclease activity A Shewanella sediminis (strain HAW-EB3)
A1SZR8 1.49e-63 196 59 0 166 3 rraA Regulator of ribonuclease activity A Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q15NG9 1.51e-63 196 55 0 156 3 rraA Regulator of ribonuclease activity A Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
B4S2E4 4.23e-63 194 58 0 158 3 rraA Regulator of ribonuclease activity A Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
C4LBS7 1.77e-62 193 60 0 156 3 rraA Regulator of ribonuclease activity A Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
C1DHC2 4.44e-62 192 56 0 160 3 Avin_23290 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q4KFJ3 5.05e-60 187 53 0 162 3 PFL_1871 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q883Q6 5.52e-60 186 55 0 160 3 PSPTO_2294 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q3IJD2 6.63e-60 186 57 0 152 3 rraA Regulator of ribonuclease activity A Pseudoalteromonas translucida (strain TAC 125)
Q9I2W7 1.03e-59 186 55 0 160 1 PA1772 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02KR3 1.03e-59 186 55 0 160 1 PA14_41640 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Pseudomonas aeruginosa (strain UCBPP-PA14)
B7VBA7 1.03e-59 186 55 0 160 3 PLES_35571 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Pseudomonas aeruginosa (strain LESB58)
Q5QV38 1.65e-59 185 56 0 158 3 rraA Regulator of ribonuclease activity A Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q1ICM4 1.92e-59 185 53 0 160 3 PSEEN1744 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Pseudomonas entomophila (strain L48)
Q88L51 2.41e-59 185 53 0 160 3 PP_2084 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5W6M0 3.1e-59 185 53 0 160 3 Pput_3656 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
A4XU32 4.86e-59 184 55 0 160 3 Pmen_2087 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Pseudomonas mendocina (strain ymp)
Q9S4U0 7.94e-59 184 53 0 160 3 None Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Pseudomonas fluorescens
B0KG79 9.25e-59 183 53 0 160 3 PputGB1_1595 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Pseudomonas putida (strain GB-1)
Q47VZ9 1.17e-58 183 56 0 152 3 rraA Regulator of ribonuclease activity A Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
A4VL60 2.17e-58 182 53 0 160 3 PST_2040 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Stutzerimonas stutzeri (strain A1501)
C3K0T6 6.26e-58 181 51 0 162 3 PFLU_4617 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Pseudomonas fluorescens (strain SBW25)
A6V753 1.09e-57 181 53 0 159 3 PSPA7_3534 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Pseudomonas aeruginosa (strain PA7)
Q3KFE1 1.42e-57 181 51 0 162 3 Pfl01_1772 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Pseudomonas fluorescens (strain Pf0-1)
Q48JZ3 1.43e-57 181 53 1 162 3 PSPPH_2063 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q4ZUN7 8.82e-57 178 52 0 160 3 Psyr_2092 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Pseudomonas syringae pv. syringae (strain B728a)
B1J596 5.96e-56 176 51 0 160 3 PputW619_1602 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Pseudomonas putida (strain W619)
Q2SK70 1.57e-55 175 49 0 162 3 HCH_02125 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Hahella chejuensis (strain KCTC 2396)
Q47BF5 1.62e-49 160 48 1 162 3 Daro_3096 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Dechloromonas aromatica (strain RCB)
Q3BRB4 8.58e-47 153 45 1 159 3 XCV2968 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PIT8 1.3e-46 153 45 1 159 3 XAC2807 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Xanthomonas axonopodis pv. citri (strain 306)
A6VX14 1.43e-46 152 44 0 156 3 Mmwyl1_2071 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Marinomonas sp. (strain MWYL1)
Q8P7H4 2.64e-46 152 45 1 159 3 XCC2637 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UWM5 2.64e-46 152 45 1 159 3 XC_1480 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Xanthomonas campestris pv. campestris (strain 8004)
B0RQZ0 3.86e-46 152 45 1 159 3 xcc-b100_1525 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Xanthomonas campestris pv. campestris (strain B100)
C1D7M1 4.82e-46 151 47 0 156 3 LHK_01472 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Laribacter hongkongensis (strain HLHK9)
Q0A9G6 8.01e-46 150 47 0 153 3 Mlg_1172 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q5P203 1.01e-45 150 45 0 156 3 AZOSEA25360 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
B2SSI8 1.77e-45 150 44 1 159 3 PXO_04832 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P5H9 1.77e-45 150 44 1 159 3 XOO1443 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q6FCF4 4.34e-43 144 46 2 162 3 ACIAD1391 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q63SX7 4.05e-42 141 46 1 158 3 BPSL2194 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Burkholderia pseudomallei (strain K96243)
A3NAY8 4.05e-42 141 46 1 158 3 BURPS668_2477 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Burkholderia pseudomallei (strain 668)
Q3JQZ3 4.05e-42 141 46 1 158 3 BURPS1710b_2618 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Burkholderia pseudomallei (strain 1710b)
A3NWR9 4.05e-42 141 46 1 158 3 BURPS1106A_2531 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Burkholderia pseudomallei (strain 1106a)
A1V5A8 4.05e-42 141 46 1 158 3 BMASAVP1_A2095 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Burkholderia mallei (strain SAVP1)
Q62J86 4.05e-42 141 46 1 158 3 BMA1593 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Burkholderia mallei (strain ATCC 23344)
A2SB35 4.05e-42 141 46 1 158 3 BMA10229_A3218 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Burkholderia mallei (strain NCTC 10229)
A3MKY3 4.05e-42 141 46 1 158 3 BMA10247_1368 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Burkholderia mallei (strain NCTC 10247)
Q2SX33 3.81e-41 139 47 1 161 3 BTH_I1992 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q0VQ55 6.8e-41 138 45 1 159 3 ABO_1245 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q9KPK1 1.13e-40 137 41 0 154 1 VC_2366 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q5SIP7 3.29e-40 136 44 1 153 1 TTHA1322 4-hydroxy-4-methyl-2-oxoglutarate aldolase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q607E7 4.36e-40 136 45 1 155 3 MCA1813 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q7NXI6 1.08e-39 135 42 0 157 3 CV_1640 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
A9AHQ6 2.16e-39 134 41 1 163 3 Bmul_1223 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Burkholderia multivorans (strain ATCC 17616 / 249)
Q9M8R9 5.17e-39 133 40 1 161 2 At3g02770 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase 1 Arabidopsis thaliana
Q72J23 5.44e-39 133 43 1 153 3 TT_C0958 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
Q9FFE0 7.01e-39 133 41 1 161 1 At5g16450 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase 2 Arabidopsis thaliana
B2JIG2 1.4e-38 132 42 1 161 3 Bphy_1374 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q8FQY0 1.55e-38 132 41 0 160 3 CE0987 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
B6IPN3 2.31e-38 132 42 0 150 3 RC1_2349 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Rhodospirillum centenum (strain ATCC 51521 / SW)
Q21X23 3.85e-38 131 41 2 167 3 Rfer_1955 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q87SD2 5.17e-38 130 38 0 150 3 VP0492 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q9FH13 1.93e-37 129 40 1 164 1 At5g56260 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase 3 Arabidopsis thaliana
A3Q7S1 1.93e-37 129 43 0 149 3 Mjls_5435 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Mycobacterium sp. (strain JLS)
Q6LUQ3 2.27e-37 129 38 0 154 3 PBPRA0549 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Photobacterium profundum (strain SS9)
Q5Z3P5 2.56e-37 129 44 0 149 3 NFA_1040 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Nocardia farcinica (strain IFM 10152)
Q7MNR7 3.9e-37 128 38 0 150 3 VV0648 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Vibrio vulnificus (strain YJ016)
Q8DEP0 3.9e-37 128 38 0 150 3 VV1_0547 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Vibrio vulnificus (strain CMCP6)
B8GM40 5.38e-37 128 41 0 149 3 Tgr7_2551 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q9CDD2 1.42e-36 127 44 0 149 3 ML0066 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Mycobacterium leprae (strain TN)
B8ZTT3 1.42e-36 127 44 0 149 3 MLBr00066 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Mycobacterium leprae (strain Br4923)
Q1B1S4 1.42e-36 127 42 0 149 3 Mmcs_5056 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Mycobacterium sp. (strain MCS)
A1UNC5 1.42e-36 127 42 0 149 3 Mkms_5144 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Mycobacterium sp. (strain KMS)
B2SXN2 1.63e-36 127 40 1 162 3 Bphyt_2492 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
A0R664 1.85e-36 127 42 0 156 1 rraA Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q0K9J4 2.4e-36 127 41 1 156 3 H16_A2230 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
B3R2J3 3.4e-36 126 41 1 156 3 RALTA_A1769 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q13X79 3.64e-36 126 40 1 162 3 Bxeno_A2772 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Paraburkholderia xenovorans (strain LB400)
Q46ZV6 8e-36 125 42 1 156 3 Reut_A1963 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
P9WGY3 1.23e-35 124 42 0 149 1 rraA Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGY2 1.23e-35 124 42 0 149 3 rraA Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U9I2 1.23e-35 124 42 0 149 3 MRA_3893 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AIV9 1.23e-35 124 42 0 149 3 JTY_3918 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KQI8 1.23e-35 124 42 0 149 3 BCG_3916 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P0A667 1.23e-35 124 42 0 149 3 BQ2027_MB3883 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q8XZP1 1.97e-35 124 43 1 155 3 RSc1354 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
A4T3Z0 2.1e-35 124 45 0 149 3 Mflv_1124 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Mycolicibacterium gilvum (strain PYR-GCK)
Q8NRW6 2.16e-35 124 40 0 154 3 Cgl0925 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q4JVU3 8.26e-35 123 40 0 151 3 jk0900 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Corynebacterium jeikeium (strain K411)
A1TGZ7 9.34e-34 120 42 0 149 3 Mvan_5682 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q9RW10 1.1e-33 120 39 1 154 3 DR_0859 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
A4FBN0 2.44e-33 119 42 0 151 3 SACE_2149 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
A1WU91 3.69e-32 116 42 1 160 3 Hhal_0465 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Halorhodospira halophila (strain DSM 244 / SL1)
Q734S7 1.88e-30 111 38 0 156 3 BCE_3327 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Bacillus cereus (strain ATCC 10987 / NRS 248)
Q638R8 3.88e-30 110 38 0 156 3 BCE33L3012 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Bacillus cereus (strain ZK / E33L)
Q8EE23 6.29e-30 110 36 0 149 3 SO_2567 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q81N49 1.82e-28 106 37 0 156 3 BA_3368 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Bacillus anthracis
Q745I2 4.94e-28 105 44 0 150 3 MAP_0181c Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0Q981 7.09e-28 105 44 0 149 3 MAV_0174 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Mycobacterium avium (strain 104)
Q9KBI9 0.000104 44 24 2 138 3 BH1938 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q58060 0.000452 42 26 5 173 4 MJ0644 Uncharacterized protein MJ0644 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_14045
Feature type CDS
Gene rraA
Product ribonuclease E activity regulator RraA
Location 21367 - 21900 (strand: -1)
Length 534 (nucleotides) / 177 (amino acids)
In genomic island -

Contig

Accession ZDB_224
Length 134704 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1800
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF03737 Aldolase/RraA

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0684 Translation, ribosomal structure and biogenesis (J) J RNA degradosome component RraA (regulator of RNase E activity)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02553 regulator of ribonuclease activity A - -

Protein Sequence

MKNDTFDTSELCDIYQENVNVVEPLFSNFGGCSSFAGQITTVKCFEDNGLLFDLLEEEGEGRILLVDGGGSVRRALVDAELAALAVQNGWEGIVVYGAVRQVDDLAEMDIGIQAMAAIPAGCGSEGIGDSDIRVNFGGVTFFSGDYLYADNTGIILSDIPLTLPEENDDDEDELTEA

Flanking regions ( +/- flanking 50bp)

GTGAAGGGGCTATACTGACTGTATCCGGCAGCAACCAGACGTAAAATCCTATGAAAAATGATACCTTCGACACCTCCGAGCTTTGTGACATTTACCAGGAAAATGTGAATGTCGTTGAACCCCTGTTTTCCAACTTCGGGGGTTGTTCATCGTTTGCGGGGCAAATCACCACCGTAAAATGCTTTGAAGATAACGGACTGCTCTTTGATCTCCTGGAAGAAGAGGGAGAGGGCCGTATTCTCCTCGTTGACGGGGGCGGATCTGTCCGCCGTGCGCTGGTTGACGCAGAACTCGCGGCACTGGCTGTGCAGAATGGCTGGGAAGGTATTGTGGTGTACGGCGCGGTACGTCAGGTGGATGATCTGGCTGAAATGGATATCGGTATCCAGGCGATGGCCGCGATTCCGGCAGGCTGTGGTTCAGAAGGTATCGGCGACAGTGACATCCGCGTGAATTTCGGCGGTGTGACCTTCTTCTCCGGCGATTATCTGTATGCGGATAACACCGGGATTATCCTGTCAGATATCCCGCTGACGCTTCCGGAAGAAAATGATGACGATGAAGACGAGCTGACCGAAGCGTAATTCTCATCAGATACACAGACAACAAAAAGGGCGGATATCCGCCCTTTTGT