Homologs in group_2949

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15620 FBDBKF_15620 47.5 Morganella morganii S1 alpA Phage transcriptional regulator, AlpA
EHELCC_15980 EHELCC_15980 47.5 Morganella morganii S2 alpA Phage transcriptional regulator, AlpA
NLDBIP_16390 NLDBIP_16390 47.5 Morganella morganii S4 alpA Phage transcriptional regulator, AlpA
LHKJJB_16415 LHKJJB_16415 47.5 Morganella morganii S3 alpA Phage transcriptional regulator, AlpA
HKOGLL_16185 HKOGLL_16185 47.5 Morganella morganii S5 alpA Phage transcriptional regulator, AlpA

Distribution of the homologs in the orthogroup group_2949

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2949

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P9WKT7 3.91e-05 40 31 0 48 1 Rv0500A Putative DNA-binding protein Rv0500A Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WKT6 3.91e-05 40 31 0 48 4 MT0521 Putative DNA-binding protein MT0521 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS15555
Feature type CDS
Gene -
Product helix-turn-helix domain-containing protein
Location 3461648 - 3461830 (strand: -1)
Length 183 (nucleotides) / 60 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2949
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF12728 Helix-turn-helix domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3311 Transcription (K)
Mobilome: prophages, transposons (X)		 KX DNA-binding transcriptional regulator AlpA

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07733 prophage regulatory protein - -

Protein Sequence

MSDEILTLKELADYLKLAEKTTYRLTAEGKLPGFKVGGSWRFRKSDIDSWITKQKNSGYR

Flanking regions ( +/- flanking 50bp)

ACTCCTCAATTTTCTCATATTCTCGCTTCCTAGAAAATTGAGGGGTTACTATGTCTGATGAAATACTCACACTTAAAGAGCTGGCTGATTATCTCAAGCTAGCTGAAAAGACTACATACAGGTTGACAGCAGAGGGTAAATTACCAGGATTTAAAGTCGGAGGTAGTTGGCGCTTTAGAAAAAGTGACATTGATAGCTGGATAACCAAACAAAAAAATAGTGGGTATCGATAGATTTCTACTATCCTCTGATGTATCTTAACCTCAATAACTGTTTTTATATA