Homologs in group_3648

Help

4 homologs were identified in 2 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
F4V73_RS17005 F4V73_RS17005 23.5 Morganella psychrotolerans cueR Cu(I)-responsive transcriptional regulator
F4V73_RS17030 F4V73_RS17030 23.9 Morganella psychrotolerans - MerR family transcriptional regulator
PMI_RS10150 PMI_RS10150 26.9 Proteus mirabilis HI4320 cueR Cu(I)-responsive transcriptional regulator
PMI_RS18275 PMI_RS18275 30.1 Proteus mirabilis HI4320 - MerR family transcriptional regulator

Distribution of the homologs in the orthogroup group_3648

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3648

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ACS4 5.09e-55 172 59 0 149 3 soxR Redox-sensitive transcriptional activator SoxR Shigella flexneri
P0ACS2 5.09e-55 172 59 0 149 1 soxR Redox-sensitive transcriptional activator SoxR Escherichia coli (strain K12)
P0ACS3 5.09e-55 172 59 0 149 3 soxR Redox-sensitive transcriptional activator SoxR Escherichia coli O157:H7
P0A2R0 1.22e-54 171 58 0 149 3 soxR Redox-sensitive transcriptional activator SoxR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2R1 1.22e-54 171 58 0 149 3 soxR Redox-sensitive transcriptional activator SoxR Salmonella typhi
Q51506 5.56e-49 157 55 0 141 3 soxR Redox-sensitive transcriptional activator SoxR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9ZHI4 1.71e-35 123 49 0 138 4 soxR HTH-type transcriptional activator SoxR homolog Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q9X5V4 6.51e-11 59 26 2 122 4 hmrR HTH-type transcriptional regulator HmrR Rhizobium leguminosarum bv. viciae
P22896 2.34e-10 57 31 2 109 4 merR Mercuric resistance operon regulatory protein (Fragment) Acidithiobacillus ferrooxidans
P0A2Q9 1.34e-08 53 31 6 129 4 merR Mercuric resistance operon regulatory protein Shigella flexneri
P0A2Q8 1.34e-08 53 31 6 129 3 merR Mercuric resistance operon regulatory protein Salmonella typhi
Q55963 1.79e-08 53 28 2 114 4 slr0701 Uncharacterized HTH-type transcriptional regulator slr0701 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P13111 4.21e-08 52 41 1 67 4 merR Mercuric resistance operon regulatory protein Serratia marcescens
P69413 6.12e-08 52 41 1 67 3 merR Mercuric resistance operon regulatory protein Pseudomonas sp.
P0A184 6.12e-08 52 41 1 67 3 merR Mercuric resistance operon regulatory protein Pseudomonas fluorescens
P0A183 6.12e-08 52 41 1 67 1 merR Mercuric resistance operon regulatory protein Pseudomonas aeruginosa
P0A4T9 8.61e-08 52 27 2 122 1 tipA HTH-type transcriptional activator TipA Streptomyces lividans
P0A4T8 8.61e-08 52 27 2 122 3 tipA HTH-type transcriptional activator TipA Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P50329 6.82e-06 47 36 1 65 4 nolA Nodulation protein NolA (Fragment) Bradyrhizobium elkanii
P50330 7.82e-06 47 36 1 65 4 nolA Nodulation protein NolA Bradyrhizobium sp. (strain NC92)
P58379 8.16e-06 46 23 3 123 3 hmrR2 Heavy metal-dependent transcription regulator 2 Rhizobium meliloti (strain 1021)
Q9HV30 3.72e-05 44 26 4 126 3 PA4778 Uncharacterized HTH-type transcriptional regulator PA4778 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P45277 5.35e-05 43 30 2 106 3 zntR HTH-type transcriptional regulator ZntR homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P22537 7.94e-05 44 35 1 65 2 nolA Nodulation protein NolA Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q9X5X4 8.83e-05 43 23 3 123 1 hmrR HTH-type transcriptional regulator HmrR Sinorhizobium medicae (strain WSM419)
Q8Z8S3 8.93e-05 43 26 2 101 3 cueR HTH-type transcriptional regulator CueR Salmonella typhi
Q93CH6 9.69e-05 43 30 1 70 1 cueR HTH-type transcriptional regulator CueR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8FK74 0.000112 43 25 2 106 3 cueR HTH-type transcriptional regulator CueR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P96690 0.000202 43 28 1 99 4 ydfL Uncharacterized HTH-type transcriptional regulator YdfL Bacillus subtilis (strain 168)
P22853 0.000213 42 34 1 66 1 merR1 Mercuric resistance operon regulatory protein Bacillus cereus
Q8XD09 0.000252 42 25 2 106 3 cueR HTH-type transcriptional regulator CueR Escherichia coli O157:H7
P71039 0.000305 42 32 1 99 1 mta HTH-type transcriptional activator mta Bacillus subtilis (strain 168)
P0A9G5 0.000308 42 28 3 101 3 cueR HTH-type transcriptional regulator CueR Shigella flexneri
P0A9G4 0.000308 42 28 3 101 1 cueR HTH-type transcriptional regulator CueR Escherichia coli (strain K12)
Q8ZCA8 0.000492 41 24 3 104 3 cueR HTH-type transcriptional regulator CueR Yersinia pestis
O06474 0.000793 40 28 4 113 2 yfmP HTH-type transcriptional regulator YfmP Bacillus subtilis (strain 168)
P44617 0.001 40 26 4 125 3 HI_0293 Probable heavy metal-dependent transcriptional regulator HI_0293 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS13330
Feature type CDS
Gene soxR
Product redox-sensitive transcriptional activator SoxR
Location 2954837 - 2955286 (strand: -1)
Length 450 (nucleotides) / 149 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_3648
Orthogroup size 5
N. genomes 2

Actions

Genomic region

Domains

PF00376 MerR family regulatory protein
PF09278 MerR, DNA binding

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0789 Transcription (K) K DNA-binding transcriptional regulator, MerR family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K13639 MerR family transcriptional regulator, redox-sensitive transcriptional activator SoxR - -

Protein Sequence

MSKEKIDFNRALTVGEVAKRSGVAISTLHFYEEKGLIKSSRSPGNQRRYPSVVLRYVAIIKAAQSTGIPLKEIQEILGKYPPNSKLTAEQWHEISTDWKIRLDERIRRLKRLRNGLDHCIGCGCLSLNDCPLRNPDDILGEKGPGAQML

Flanking regions ( +/- flanking 50bp)

TAAAACCTCAAGTTAACTTGAGGTCAAGTGAAAAATAAAAAAGGTAGCAAATGAGTAAAGAGAAAATAGATTTTAATCGAGCGCTCACGGTTGGCGAAGTGGCAAAACGCAGTGGTGTTGCGATTTCTACACTGCATTTTTATGAAGAAAAAGGATTGATAAAAAGTTCTCGGAGCCCTGGAAATCAGCGCCGTTACCCGTCAGTGGTACTTCGTTATGTGGCAATTATTAAAGCAGCGCAGAGTACAGGTATTCCATTAAAAGAAATTCAGGAAATATTAGGGAAATATCCACCAAATAGTAAATTAACTGCAGAACAATGGCATGAAATATCAACGGATTGGAAAATACGGCTCGATGAGCGTATTCGGCGTCTTAAGCGATTACGTAATGGACTTGATCACTGTATTGGCTGTGGATGCCTATCATTAAATGATTGCCCATTACGTAACCCTGATGATATTTTAGGGGAAAAAGGGCCTGGTGCTCAAATGTTATGATCACAATGAAAATGTCACCCTATCAGGCTTAAAAAAACCTTCGAATTCAT