Homologs in group_3648

Help

4 homologs were identified in 2 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
F4V73_RS17005 F4V73_RS17005 35.7 Morganella psychrotolerans cueR Cu(I)-responsive transcriptional regulator
PMI_RS10150 PMI_RS10150 31.0 Proteus mirabilis HI4320 cueR Cu(I)-responsive transcriptional regulator
PMI_RS13330 PMI_RS13330 23.9 Proteus mirabilis HI4320 soxR redox-sensitive transcriptional activator SoxR
PMI_RS18275 PMI_RS18275 24.6 Proteus mirabilis HI4320 - MerR family transcriptional regulator

Distribution of the homologs in the orthogroup group_3648

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3648

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P45277 9.62e-24 92 41 0 112 3 zntR HTH-type transcriptional regulator ZntR homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P22853 1.43e-21 86 33 0 128 1 merR1 Mercuric resistance operon regulatory protein Bacillus cereus
P22874 2.56e-20 83 31 0 129 4 merR Mercuric resistance operon regulatory protein Staphylococcus aureus
Q8ZCA8 2.64e-17 75 33 1 127 3 cueR HTH-type transcriptional regulator CueR Yersinia pestis
Q9X5X4 3.37e-17 75 30 1 127 1 hmrR HTH-type transcriptional regulator HmrR Sinorhizobium medicae (strain WSM419)
P58379 8.67e-17 74 31 0 111 3 hmrR2 Heavy metal-dependent transcription regulator 2 Rhizobium meliloti (strain 1021)
Q93CH6 9.69e-17 74 31 1 127 1 cueR HTH-type transcriptional regulator CueR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A9G5 1.29e-16 73 29 1 127 3 cueR HTH-type transcriptional regulator CueR Shigella flexneri
P0A9G4 1.29e-16 73 29 1 127 1 cueR HTH-type transcriptional regulator CueR Escherichia coli (strain K12)
Q8XD09 1.55e-16 73 29 1 127 3 cueR HTH-type transcriptional regulator CueR Escherichia coli O157:H7
Q8FK74 1.68e-16 73 29 1 127 3 cueR HTH-type transcriptional regulator CueR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8Z8S3 2.06e-16 73 30 1 127 3 cueR HTH-type transcriptional regulator CueR Salmonella typhi
Q9X5V4 1.52e-15 70 35 1 108 4 hmrR HTH-type transcriptional regulator HmrR Rhizobium leguminosarum bv. viciae
P44617 2.46e-14 67 32 0 105 3 HI_0293 Probable heavy metal-dependent transcriptional regulator HI_0293 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9HV30 2.97e-14 67 31 1 129 3 PA4778 Uncharacterized HTH-type transcriptional regulator PA4778 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P58378 5.3e-14 67 32 1 112 3 hmrR1 Heavy metal-dependent transcription regulator 1 Rhizobium meliloti (strain 1021)
P0C6D2 1.81e-13 65 28 1 127 3 cueR HTH-type transcriptional regulator CueR Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F2W6 1.81e-13 65 28 1 127 3 cueR HTH-type transcriptional regulator CueR Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
P0ACS5 3.02e-13 65 26 2 128 1 zntR HTH-type transcriptional regulator ZntR Escherichia coli (strain K12)
P0ACS6 3.02e-13 65 26 2 128 3 zntR HTH-type transcriptional regulator ZntR Escherichia coli O157:H7
P69413 2.21e-12 63 29 1 127 3 merR Mercuric resistance operon regulatory protein Pseudomonas sp.
P0A184 2.21e-12 63 29 1 127 3 merR Mercuric resistance operon regulatory protein Pseudomonas fluorescens
P0A183 2.21e-12 63 29 1 127 1 merR Mercuric resistance operon regulatory protein Pseudomonas aeruginosa
P13111 5.23e-12 62 28 1 127 4 merR Mercuric resistance operon regulatory protein Serratia marcescens
P22896 2.12e-11 60 29 0 106 4 merR Mercuric resistance operon regulatory protein (Fragment) Acidithiobacillus ferrooxidans
P0A2Q9 1.17e-10 58 27 1 127 4 merR Mercuric resistance operon regulatory protein Shigella flexneri
P0A2Q8 1.17e-10 58 27 1 127 3 merR Mercuric resistance operon regulatory protein Salmonella typhi
Q55963 2.5e-08 52 24 0 105 4 slr0701 Uncharacterized HTH-type transcriptional regulator slr0701 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P96690 1.35e-07 52 34 4 107 4 ydfL Uncharacterized HTH-type transcriptional regulator YdfL Bacillus subtilis (strain 168)
O06008 6.4e-07 48 37 0 59 1 adhR HTH-type transcriptional regulator AdhR Bacillus subtilis (strain 168)
P50330 7.61e-07 49 25 1 108 4 nolA Nodulation protein NolA Bradyrhizobium sp. (strain NC92)
P37510 3.07e-06 47 33 1 69 4 yyaN Uncharacterized HTH-type transcriptional regulator YyaN Bacillus subtilis (strain 168)
P39842 3.32e-06 48 31 2 119 4 bltR Multidrug-efflux transporter 2 regulator Bacillus subtilis (strain 168)
P50329 2.15e-05 45 29 1 75 4 nolA Nodulation protein NolA (Fragment) Bradyrhizobium elkanii
O07586 4.74e-05 43 33 1 63 4 cueR HTH-type transcriptional regulator CueR Bacillus subtilis (strain 168)
O06474 0.000119 42 33 1 69 2 yfmP HTH-type transcriptional regulator YfmP Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS17030
Feature type CDS
Gene -
Product MerR family transcriptional regulator
Location 30175 - 30573 (strand: 1)
Length 399 (nucleotides) / 132 (amino acids)

Contig

Accession term accessions NZ_VXKB01000007 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 196482 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3648
Orthogroup size 5
N. genomes 2

Actions

Genomic region

Domains

PF13411 MerR HTH family regulatory protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0789 Transcription (K) K DNA-binding transcriptional regulator, MerR family

Protein Sequence

MKIGDMSNLFNIPRETIRFYEREGLMLPPNRKDNNYRSYSKNHIERLRFIKNCRSLNMSHREIKKLLNLIDNNKDDCALVEEVIVSHLSEIRKNIKRLKQLEKDLINLQEHSNEIEASNKCGIIKNLLSIDI

Flanking regions ( +/- flanking 50bp)

TCAGTACTATTTTTATCAAAAAAACAACATTAAACCCCGGGTAATAAATAATGAAAATAGGTGATATGTCGAATTTATTTAATATTCCACGAGAAACGATTCGCTTCTATGAACGGGAAGGTTTGATGTTACCTCCGAACAGAAAGGATAATAACTACCGGAGTTATAGCAAAAATCATATTGAACGATTACGATTTATAAAAAATTGCCGAAGCCTTAATATGTCCCATCGCGAGATTAAAAAACTATTAAATCTCATTGATAACAATAAAGATGATTGTGCCTTAGTGGAAGAAGTTATTGTCAGTCACTTATCTGAAATACGAAAAAATATTAAGCGGTTAAAGCAATTAGAAAAAGACCTTATCAACTTACAGGAACATAGTAATGAAATAGAGGCCAGTAATAAATGCGGAATAATAAAAAATCTTTTATCTATAGATATTTAATCATTATAACGTTGTGCCGGATAACTAACGAAATTATCATAAAAAAATGC