Homologs in group_484

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_13845 FBDBKF_13845 85.9 Morganella morganii S1 terZ Stress response protein SCP2
EHELCC_11515 EHELCC_11515 85.9 Morganella morganii S2 terZ Stress response protein SCP2
NLDBIP_11860 NLDBIP_11860 85.9 Morganella morganii S4 terZ Stress response protein SCP2
LHKJJB_11720 LHKJJB_11720 85.9 Morganella morganii S3 terZ Stress response protein SCP2
HKOGLL_10330 HKOGLL_10330 85.9 Morganella morganii S5 terZ Stress response protein SCP2
F4V73_RS12710 F4V73_RS12710 86.5 Morganella psychrotolerans - TerD family protein

Distribution of the homologs in the orthogroup group_484

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_484

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q52357 3.88e-131 368 92 0 192 3 terD Tellurium resistance protein TerD Serratia marcescens
P18781 7.67e-130 365 92 0 192 3 terD Tellurium resistance protein TerD Alcaligenes sp.
P18782 4.46e-94 275 66 0 190 3 terE Tellurium resistance protein TerE Alcaligenes sp.
Q52358 2.89e-91 267 64 0 190 3 terE Tellurium resistance protein TerE Serratia marcescens
P80875 7.96e-78 233 57 1 190 1 yceD General stress protein 16U Bacillus subtilis (strain 168)
O34384 1.4e-73 223 53 1 190 3 yceE Uncharacterized protein YceE Bacillus subtilis (strain 168)
Q45812 3.08e-71 217 52 1 192 3 None Chemical-damaging agent resistance protein C Clostridium acetobutylicum
P34122 7.17e-66 206 50 1 193 1 capB cAMP-binding protein 2 Dictyostelium discoideum
P19198 1.75e-54 179 44 1 190 2 capA-1 cAMP-binding protein 1 Dictyostelium discoideum
Q45811 5e-47 154 55 0 138 3 None Chemical-damaging agent resistance protein B Clostridium acetobutylicum
P81100 2.9e-46 154 40 2 186 1 yceC Stress response protein SCP2 Bacillus subtilis (strain 168)
P75012 2.12e-40 139 40 4 199 3 terX Tellurium resistance protein TerX Serratia marcescens
Q52353 2.94e-33 120 40 5 185 3 terZ Tellurium resistance protein TerZ Serratia marcescens
P73042 2.27e-18 81 31 6 183 3 slr1764 Uncharacterized protein slr1764 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P18778 3.66e-11 64 27 4 136 4 terA Tellurium resistance protein TerA Alcaligenes sp.

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS11795
Feature type CDS
Gene terD
Product tellurium resistance membrane protein TerD
Location 2608400 - 2608978 (strand: -1)
Length 579 (nucleotides) / 192 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_484
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02342 TerD domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2310 Signal transduction mechanisms (T) T Stress response protein SCP2

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K05795 tellurium resistance protein TerD - -

AMR gene Annotation(s)

Gene Description Scope Type Class Subclass HMM
terD tellurium resistance membrane protein TerD plus STRESS TELLURIUM TELLURIUM None

Protein Sequence

MSVSLSKGGNVSLSKAAPTMKNVLVGLGWDARSTDGQDFDLDASAFLLAANGKVRSDADFIFYNNLRSADGSVVHTGDNRTGEGDGDDEALKIKLDTIPSDVEKIIFVVTIHEAQARRQSFGQVSGAFIRLVNDDNQIEVARYDLTEDASTETAMLFGELYRHNGEWKFRAVGQGYAGGLGSVCAQYGINAS

Flanking regions ( +/- flanking 50bp)

GATATTCTTGGGAAATTAGAATATCGCAACATAAATTGAAGAGGTTGAAGATGAGCGTTTCTCTTTCTAAAGGTGGTAATGTTTCTTTAAGCAAAGCAGCCCCAACGATGAAAAACGTCCTAGTCGGACTTGGTTGGGATGCCCGTTCTACAGATGGTCAAGATTTTGACTTAGATGCATCTGCATTTCTGTTAGCCGCTAATGGAAAAGTACGTAGCGATGCCGATTTCATTTTTTATAACAACTTAAGATCTGCCGACGGCTCTGTTGTTCACACTGGTGATAACCGAACAGGTGAAGGTGATGGTGATGATGAAGCACTAAAAATCAAACTAGATACCATCCCCAGTGATGTCGAAAAAATTATCTTTGTAGTGACTATCCATGAAGCGCAAGCGCGTCGTCAAAGCTTTGGTCAGGTATCTGGTGCGTTTATTCGTTTAGTTAATGATGACAACCAAATTGAAGTTGCTCGTTATGATTTAACGGAAGATGCATCAACGGAAACGGCGATGTTATTTGGTGAGTTATATCGTCATAACGGTGAGTGGAAATTCCGTGCTGTAGGCCAAGGATATGCAGGGGGCTTAGGCTCAGTATGTGCGCAATATGGTATTAACGCCTCTTAATCGTATGTTATGAAATCACAAATTACTGGCAGTTATTCCTAATTGTCAGT