Homologs in group_484

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_13845 FBDBKF_13845 94.8 Morganella morganii S1 terZ Stress response protein SCP2
EHELCC_11515 EHELCC_11515 94.8 Morganella morganii S2 terZ Stress response protein SCP2
NLDBIP_11860 NLDBIP_11860 94.8 Morganella morganii S4 terZ Stress response protein SCP2
LHKJJB_11720 LHKJJB_11720 94.8 Morganella morganii S3 terZ Stress response protein SCP2
HKOGLL_10330 HKOGLL_10330 94.8 Morganella morganii S5 terZ Stress response protein SCP2
PMI_RS11795 PMI_RS11795 86.5 Proteus mirabilis HI4320 terD tellurium resistance membrane protein TerD

Distribution of the homologs in the orthogroup group_484

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_484

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q52357 9.38e-127 357 88 0 192 3 terD Tellurium resistance protein TerD Serratia marcescens
P18781 1.46e-125 354 88 0 192 3 terD Tellurium resistance protein TerD Alcaligenes sp.
P18782 2.73e-90 265 63 0 190 3 terE Tellurium resistance protein TerE Alcaligenes sp.
Q52358 2.57e-88 260 63 0 190 3 terE Tellurium resistance protein TerE Serratia marcescens
P80875 5.48e-80 239 58 1 190 1 yceD General stress protein 16U Bacillus subtilis (strain 168)
O34384 5.89e-75 226 55 1 190 3 yceE Uncharacterized protein YceE Bacillus subtilis (strain 168)
Q45812 4.41e-74 224 55 1 192 3 None Chemical-damaging agent resistance protein C Clostridium acetobutylicum
P34122 5.55e-64 202 49 1 193 1 capB cAMP-binding protein 2 Dictyostelium discoideum
P19198 2.31e-57 186 46 1 190 2 capA-1 cAMP-binding protein 1 Dictyostelium discoideum
P81100 2.14e-47 156 41 2 186 1 yceC Stress response protein SCP2 Bacillus subtilis (strain 168)
Q45811 1.29e-46 152 55 0 138 3 None Chemical-damaging agent resistance protein B Clostridium acetobutylicum
P75012 5.7e-44 148 41 4 199 3 terX Tellurium resistance protein TerX Serratia marcescens
Q52353 8.46e-33 119 40 5 185 3 terZ Tellurium resistance protein TerZ Serratia marcescens
P73042 1.02e-19 85 32 6 183 3 slr1764 Uncharacterized protein slr1764 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P18778 9.16e-11 63 27 4 133 4 terA Tellurium resistance protein TerA Alcaligenes sp.

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS12710
Feature type CDS
Gene -
Product TerD family protein
Location 142633 - 143211 (strand: -1)
Length 579 (nucleotides) / 192 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000003
Length 425895 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_484
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02342 TerD domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2310 Signal transduction mechanisms (T) T Stress response protein SCP2

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K05795 tellurium resistance protein TerD - -

Protein Sequence

MSVSLSKGGNVSLSKTAPSMKNVLIGLGWDVRSTDGQDFDLDASAFLLTATGKVRGDADFIFYNNLRSTDGSVSHTGDNRTGQGDGDDESLIIKLDMIPAEIDKIVFVVTIHDATARRQSFGQVSGAFIRLVNDDTNTEVARYDLTEDASTETAMLFGELYRHNSEWKFRAVGQGYAGGLASVCAEYGINAS

Flanking regions ( +/- flanking 50bp)

TAAATAAATTATCCGCCCTCCGTCACTGATTTAACTAAGGAGTAAGTGAAATGAGCGTTTCTCTTTCCAAAGGTGGCAATGTGTCACTGAGTAAAACCGCGCCTTCAATGAAAAACGTCCTGATCGGCTTAGGCTGGGATGTCCGTTCTACGGATGGTCAGGACTTTGACCTTGATGCCTCTGCTTTCCTGTTAACAGCAACCGGCAAAGTACGCGGTGATGCAGATTTTATTTTCTATAACAATCTGCGTTCAACGGACGGCTCTGTATCACATACCGGTGATAACCGCACCGGACAGGGTGATGGTGATGATGAATCACTTATCATCAAACTGGATATGATCCCGGCGGAGATTGATAAAATCGTCTTTGTCGTCACTATCCATGATGCGACGGCGCGCCGTCAGAGCTTTGGTCAGGTATCCGGCGCCTTTATCCGCCTGGTCAATGATGATACCAATACCGAAGTTGCCCGTTATGACCTGACTGAAGATGCGTCAACAGAAACGGCTATGCTGTTCGGTGAACTGTATCGTCATAACAGCGAGTGGAAATTCCGCGCTGTGGGTCAGGGATATGCCGGTGGTCTGGCATCCGTTTGTGCCGAATACGGTATCAACGCATCCTGATAATTGTTTTTTCATTTTCTTTCAGCGGGCTGGTATCCGGCCTTTCTGAT