Homologs in group_54

Help

13 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_13840 FBDBKF_13840 63.4 Morganella morganii S1 terZ Stress response protein SCP2
FBDBKF_13845 FBDBKF_13845 100.0 Morganella morganii S1 terZ Stress response protein SCP2
EHELCC_11510 EHELCC_11510 63.4 Morganella morganii S2 terZ Stress response protein SCP2
EHELCC_11515 EHELCC_11515 100.0 Morganella morganii S2 terZ Stress response protein SCP2
NLDBIP_11855 NLDBIP_11855 63.4 Morganella morganii S4 terZ Stress response protein SCP2
NLDBIP_11860 NLDBIP_11860 100.0 Morganella morganii S4 terZ Stress response protein SCP2
LHKJJB_11715 LHKJJB_11715 63.4 Morganella morganii S3 terZ Stress response protein SCP2
LHKJJB_11720 LHKJJB_11720 100.0 Morganella morganii S3 terZ Stress response protein SCP2
HKOGLL_10325 HKOGLL_10325 63.4 Morganella morganii S5 terZ Stress response protein SCP2
F4V73_RS12705 F4V73_RS12705 64.9 Morganella psychrotolerans - TerD family protein
F4V73_RS12710 F4V73_RS12710 94.8 Morganella psychrotolerans - TerD family protein
PMI_RS11790 PMI_RS11790 63.4 Proteus mirabilis HI4320 - TerD family protein
PMI_RS11795 PMI_RS11795 85.9 Proteus mirabilis HI4320 terD tellurium resistance membrane protein TerD

Distribution of the homologs in the orthogroup group_54

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_54

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q52357 1.33e-126 357 88 0 192 3 terD Tellurium resistance protein TerD Serratia marcescens
P18781 3.62e-125 353 88 0 192 3 terD Tellurium resistance protein TerD Alcaligenes sp.
P18782 6.58e-92 269 65 0 190 3 terE Tellurium resistance protein TerE Alcaligenes sp.
Q52358 1.31e-89 263 64 0 190 3 terE Tellurium resistance protein TerE Serratia marcescens
P80875 2.08e-79 238 57 1 190 1 yceD General stress protein 16U Bacillus subtilis (strain 168)
O34384 8.78e-76 228 55 1 190 3 yceE Uncharacterized protein YceE Bacillus subtilis (strain 168)
Q45812 5.89e-75 226 55 1 192 3 None Chemical-damaging agent resistance protein C Clostridium acetobutylicum
P34122 1.68e-64 203 50 1 193 1 capB cAMP-binding protein 2 Dictyostelium discoideum
P19198 1e-56 184 46 1 190 2 capA-1 cAMP-binding protein 1 Dictyostelium discoideum
P81100 2.55e-47 156 41 2 186 1 yceC Stress response protein SCP2 Bacillus subtilis (strain 168)
Q45811 1.08e-45 150 54 0 138 3 None Chemical-damaging agent resistance protein B Clostridium acetobutylicum
P75012 2.92e-45 151 42 4 199 3 terX Tellurium resistance protein TerX Serratia marcescens
Q52353 4.81e-31 114 38 5 185 3 terZ Tellurium resistance protein TerZ Serratia marcescens
P73042 2.36e-21 89 32 6 183 3 slr1764 Uncharacterized protein slr1764 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P18778 1.19e-09 59 26 4 133 4 terA Tellurium resistance protein TerA Alcaligenes sp.

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_10330
Feature type CDS
Gene terZ
Product Stress response protein SCP2
Location 148898 - 149476 (strand: -1)
Length 579 (nucleotides) / 192 (amino acids)

Contig

Accession ZDB_687
Length 188522 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_54
Orthogroup size 14
N. genomes 7

Actions

Genomic region

Domains

PF02342 TerD domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2310 Signal transduction mechanisms (T) T Stress response protein SCP2

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K05795 tellurium resistance protein TerD - -

Protein Sequence

MSVSLSKGGNVSLSKTAPSMKNVLIGLGWDVRSTDGQDFDLDASAFLLTAAGKVRGDADFIFYNNLRSSDGSVTHTGDNRTGQGDGDDESLIIKLDMIPAEIDKIVFVVTIHDAQTRRQSFGQVSGAFIRLVNDDTNTEIARYDLTEDASTETAMLFGELYRHGAEWKFRAVGQGYAGGLSSVCAQYGINAS

Flanking regions ( +/- flanking 50bp)

ATAAGTAATTATCCGCCACCCGTCACTGATTTAACTAAGGAGTAAGTGAAATGAGCGTTTCTCTTTCTAAAGGTGGTAACGTGTCGCTGAGCAAAACAGCCCCTTCAATGAAAAACGTCCTGATTGGCTTAGGCTGGGATGTTCGTTCCACAGATGGTCAGGATTTCGACCTTGATGCCTCTGCCTTTCTGCTGACCGCCGCCGGTAAAGTGCGTGGCGATGCAGACTTTATTTTCTATAACAACCTGCGTTCATCTGACGGTTCAGTCACCCATACCGGCGACAACCGCACCGGCCAGGGCGATGGTGATGATGAATCTCTGATCATCAAACTGGATATGATTCCGGCGGAGATCGACAAAATCGTCTTCGTGGTCACTATCCATGACGCGCAGACCCGCCGTCAGAGTTTCGGCCAGGTATCCGGCGCATTTATCCGCCTGGTCAATGATGATACCAATACTGAAATCGCCCGTTATGACCTGACCGAAGATGCCTCCACTGAAACCGCGATGCTGTTCGGTGAACTCTACCGTCACGGTGCTGAGTGGAAATTCCGTGCCGTCGGCCAGGGCTATGCCGGTGGTCTGTCATCAGTCTGTGCGCAGTACGGTATCAACGCATCCTGAGTATTTTTTTCAGCGGGCTGACAACCAGCCCTCTTTATAACCCGCAGCAG