Homologs in group_198

Help

8 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_11815 FBDBKF_11815 25.8 Morganella morganii S1 murP PTS N-acetylmuramic acid transporter subunit IIBC
EHELCC_14490 EHELCC_14490 25.8 Morganella morganii S2 murP PTS N-acetylmuramic acid transporter subunit IIBC
NLDBIP_15585 NLDBIP_15585 25.8 Morganella morganii S4 murP PTS N-acetylmuramic acid transporter subunit IIBC
LHKJJB_15025 LHKJJB_15025 25.8 Morganella morganii S3 murP PTS N-acetylmuramic acid transporter subunit IIBC
HKOGLL_14145 HKOGLL_14145 25.8 Morganella morganii S5 murP PTS N-acetylmuramic acid transporter subunit IIBC
F4V73_RS14840 F4V73_RS14840 25.7 Morganella psychrotolerans murP PTS N-acetylmuramic acid transporter subunit IIBC
PMI_RS01405 PMI_RS01405 27.1 Proteus mirabilis HI4320 treB PTS trehalose transporter subunit IIBC
PMI_RS17475 PMI_RS17475 25.3 Proteus mirabilis HI4320 - PTS transporter subunit EIIC

Distribution of the homologs in the orthogroup group_198

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_198

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P40739 1.29e-138 420 39 8 609 3 bglP PTS system beta-glucoside-specific EIIBCA component Bacillus subtilis (strain 168)
P08722 5.07e-115 360 34 5 631 1 bglF PTS system beta-glucoside-specific EIIBCA component Escherichia coli (strain K12)
Q9KF90 1.47e-114 359 33 9 647 3 bglP PTS system beta-glucoside-specific EIIBCA component Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P26207 5.01e-103 329 33 9 641 3 arbF PTS system beta-glucoside-specific EIIBCA component Dickeya chrysanthemi
P12655 3.05e-90 296 31 12 643 1 scrA PTS system sucrose-specific EIIBCA component Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q45298 4.12e-88 291 29 13 677 3 ptsG PTS system glucose-specific EIIBCA component Corynebacterium glutamicum
P24241 1.25e-87 284 34 4 482 3 ascF PTS system arbutin-, cellobiose-, and salicin-specific EIIBC component Escherichia coli (strain K12)
P43470 7.05e-86 284 32 17 640 3 scrA PTS system sucrose-specific EIIBCA component Pediococcus pentosaceus
Q46072 2.26e-85 284 29 12 661 4 ptsM PTS system mannose-specific EIIBCA component Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
P05306 5.97e-71 239 29 9 474 1 sacP PTS system sucrose-specific EIIBC component Bacillus subtilis (strain 168)
P15400 1.85e-60 211 30 8 462 1 sacX Probable PTS system sucrose-specific EIIBC component Bacillus subtilis (strain 168)
P22825 6.08e-57 202 28 12 492 3 scrA PTS system sucrose-specific EIIBC component Vibrio alginolyticus
Q9CJZ2 6.66e-55 197 27 10 470 3 scrA PTS system sucrose-specific EIIBC component Pasteurella multocida (strain Pm70)
P51184 4.17e-54 195 30 13 477 3 scrA PTS system sucrose-specific EIIBC component Staphylococcus xylosus
P27219 1.99e-49 181 28 9 394 3 scrA PTS system sucrose-specific EIIBC component Klebsiella pneumoniae
P08470 8.36e-49 180 27 11 466 3 scrA PTS system sucrose-specific EIIBC component Salmonella typhimurium
P39794 1.36e-46 174 28 9 436 2 treP PTS system trehalose-specific EIIBC component Bacillus subtilis (strain 168)
Q797S1 6.97e-46 172 26 7 458 3 ybbF Putative PTS system EIIBC component YbbF Bacillus subtilis (strain 168)
P36672 3.33e-41 159 27 10 429 1 treB PTS system trehalose-specific EIIBC component Escherichia coli (strain K12)
Q4L8H5 6.52e-38 150 28 14 481 3 SH0741 PTS system MurNAc-GlcNAc-specific EIIBC component Staphylococcus haemolyticus (strain JCSC1435)
Q2YV12 1.78e-31 131 25 14 485 3 SAB0132 PTS system MurNAc-GlcNAc-specific EIIBC component Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q6GKB4 2e-31 131 25 14 485 3 SAR0193 PTS system MurNAc-GlcNAc-specific EIIBC component Staphylococcus aureus (strain MRSA252)
Q7A1Y1 3.62e-31 130 25 14 485 3 MW0166 PTS system MurNAc-GlcNAc-specific EIIBC component Staphylococcus aureus (strain MW2)
Q6GCT4 3.62e-31 130 25 14 485 3 SAS0167 PTS system MurNAc-GlcNAc-specific EIIBC component Staphylococcus aureus (strain MSSA476)
Q7A804 3.62e-31 130 25 14 485 1 SA0186 PTS system MurNAc-GlcNAc-specific EIIBC component Staphylococcus aureus (strain N315)
Q99X29 3.62e-31 130 25 14 485 3 SAV0192 PTS system MurNAc-GlcNAc-specific EIIBC component Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HJI0 3.62e-31 130 25 14 485 3 SACOL0178 PTS system MurNAc-GlcNAc-specific EIIBC component Staphylococcus aureus (strain COL)
Q2G1G5 3.62e-31 130 25 14 485 3 SAOUHSC_00158 PTS system MurNAc-GlcNAc-specific EIIBC component Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FK70 3.62e-31 130 25 14 485 1 murP PTS system MurNAc-GlcNAc-specific EIIBC component Staphylococcus aureus (strain USA300)
Q8CNB2 1.02e-30 129 25 15 493 3 SE_1890 PTS system MurNAc-GlcNAc-specific EIIBC component Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HLT2 1.02e-30 129 25 15 493 3 SERP1900 PTS system MurNAc-GlcNAc-specific EIIBC component Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q9CKN5 3.98e-28 121 24 13 474 3 murP PTS system N-acetylmuramic acid-specific EIIBC component Pasteurella multocida (strain Pm70)
Q49ZN7 4.86e-28 121 26 16 484 3 SSP0594 PTS system MurNAc-GlcNAc-specific EIIBC component Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q31Y50 6.13e-27 118 25 14 469 3 murP PTS system N-acetylmuramic acid-specific EIIBC component Shigella boydii serotype 4 (strain Sb227)
Q32DC5 1.95e-26 116 25 14 469 3 murP PTS system N-acetylmuramic acid-specific EIIBC component Shigella dysenteriae serotype 1 (strain Sd197)
Q8XBJ1 2.74e-26 116 25 14 469 3 murP PTS system N-acetylmuramic acid-specific EIIBC component Escherichia coli O157:H7
Q1R8U3 2.79e-26 115 24 14 469 3 murP PTS system N-acetylmuramic acid-specific EIIBC component Escherichia coli (strain UTI89 / UPEC)
Q8FFA9 3.15e-26 115 24 14 469 3 murP PTS system N-acetylmuramic acid-specific EIIBC component Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P77272 3.42e-26 115 25 14 469 1 murP PTS system N-acetylmuramic acid-specific EIIBC component Escherichia coli (strain K12)
Q83QN3 4.19e-26 115 25 14 469 3 murP PTS system N-acetylmuramic acid-specific EIIBC component Shigella flexneri
Q8CZD5 4.83e-26 108 43 0 130 3 crr PTS system glucose-specific EIIA component Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q7N9D9 1.12e-25 114 25 15 477 3 murP PTS system N-acetylmuramic acid-specific EIIBC component Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q2YUZ1 1.9e-24 112 40 1 160 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q6GKB7 2.37e-24 111 40 1 160 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain MRSA252)
Q8NYM1 2.46e-24 111 40 1 160 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain MW2)
A8Z0F5 2.46e-24 111 40 1 160 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain USA300 / TCH1516)
Q6GCT7 2.46e-24 111 40 1 160 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain MSSA476)
A6QDH3 2.46e-24 111 40 1 160 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain Newman)
Q5HJI3 2.46e-24 111 40 1 160 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain COL)
Q2G1G8 2.46e-24 111 40 1 160 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FK73 2.46e-24 111 40 1 160 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain USA300)
Q7A807 3.24e-24 111 39 1 160 1 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain N315)
Q99X32 3.24e-24 111 39 1 160 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5IP58 3.24e-24 111 39 1 160 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain JH9)
A6TXX3 3.24e-24 111 39 1 160 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain JH1)
A7WXI2 3.24e-24 111 39 1 160 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain Mu3 / ATCC 700698)
P39816 4.16e-24 110 43 1 136 2 gamP PTS system glucosamine-specific EIICBA component Bacillus subtilis (strain 168)
P35595 7.66e-24 110 44 0 117 3 exp5 PTS system glucose-specific EIICBA component Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q814U8 8.34e-24 101 43 0 123 3 crr PTS system glucose-specific EIIA component Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q8CP79 8.99e-24 101 38 1 139 3 crr PTS system glucose-specific EIIA component Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HPB5 8.99e-24 101 38 1 139 3 crr PTS system glucose-specific EIIA component Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q81JY0 9.01e-24 101 43 0 123 3 crr PTS system glucose-specific EIIA component Bacillus anthracis
P43466 1.74e-23 108 39 1 147 3 rafP Raffinose carrier protein Pediococcus pentosaceus
Q4A0C4 2.03e-23 108 41 2 148 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q6GGY5 6.95e-23 99 40 0 125 3 crr PTS system glucose-specific EIIA component Staphylococcus aureus (strain MRSA252)
P60857 9.85e-23 98 40 0 125 1 crr PTS system glucose-specific EIIA component Staphylococcus aureus (strain N315)
P60856 9.85e-23 98 40 0 125 3 crr PTS system glucose-specific EIIA component Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q93P61 1.01e-22 98 40 0 125 3 crr PTS system glucose-specific EIIA component Staphylococcus aureus
Q5HFZ9 1.01e-22 98 40 0 125 3 crr PTS system glucose-specific EIIA component Staphylococcus aureus (strain COL)
P42015 1.03e-22 102 39 1 145 3 ptsG PTS system glucose-specific EIICBA component (Fragment) Geobacillus stearothermophilus
P42015 0.000811 45 32 1 73 3 ptsG PTS system glucose-specific EIICBA component (Fragment) Geobacillus stearothermophilus
Q8NWR1 1.03e-22 98 40 0 125 3 crr PTS system glucose-specific EIIA component Staphylococcus aureus (strain MW2)
Q6G9D9 1.03e-22 98 40 0 125 3 crr PTS system glucose-specific EIIA component Staphylococcus aureus (strain MSSA476)
Q9KCQ4 1.68e-22 98 39 0 124 3 crr PTS system glucose-specific EIIA component Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q7CCJ4 5.93e-22 104 37 1 145 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HL73 5.93e-22 104 37 1 145 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8VRH0 5.93e-22 104 37 1 145 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus epidermidis
Q5E5T6 6.2e-22 103 23 11 485 3 murP PTS system N-acetylmuramic acid-specific EIIBC component Aliivibrio fischeri (strain ATCC 700601 / ES114)
P69785 8.14e-22 96 39 0 124 3 crr PTS system glucose-specific EIIA component Shigella flexneri
P69783 8.14e-22 96 39 0 124 1 crr PTS system glucose-specific EIIA component Escherichia coli (strain K12)
P69784 8.14e-22 96 39 0 124 3 crr PTS system glucose-specific EIIA component Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P45338 8.45e-22 95 34 0 152 1 crr PTS system glucose-specific EIIA component Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5IVW5 1.31e-21 103 39 1 143 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain JH9)
A6U4R9 1.31e-21 103 39 1 143 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain JH1)
Q87FD5 1.45e-21 102 24 16 490 3 murP PTS system N-acetylmuramic acid-specific EIIBC component Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q6GDR0 1.59e-21 102 39 1 143 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain MRSA252)
Q8NUS2 1.8e-21 102 39 1 143 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain MW2)
A8Z3D6 1.8e-21 102 39 1 143 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain USA300 / TCH1516)
Q6G6D6 1.8e-21 102 39 1 143 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain MSSA476)
A6QK27 1.8e-21 102 39 1 143 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain Newman)
Q5HD13 1.8e-21 102 39 1 143 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain COL)
Q2FV87 1.8e-21 102 39 1 143 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FDW8 1.8e-21 102 39 1 143 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain USA300)
Q53922 1.86e-21 102 42 2 144 1 glcB PTS system glucoside-specific EIICBA component Staphylococcus carnosus (strain TM300)
Q2YWC1 1.88e-21 102 39 1 143 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q57071 2.36e-21 102 37 2 162 1 ptsG PTS system glucose-specific EIICBA component Staphylococcus carnosus (strain TM300)
P50829 2.63e-21 94 39 0 121 4 ptsA Phosphotransferase enzyme IIA component PtsA Bacillus subtilis (strain 168)
Q44840 2.77e-21 95 36 0 124 3 crr PTS system glucose-specific EIIA component Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
P23936 3.27e-21 101 38 2 159 3 lacS Lactose permease Streptococcus thermophilus
P0A283 4.21e-21 94 38 0 124 1 crr PTS system glucose-specific EIIA component Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A284 4.21e-21 94 38 0 124 1 crr PTS system glucose-specific EIIA component Salmonella typhi
Q7MBS2 5.85e-21 100 24 15 490 3 murP PTS system N-acetylmuramic acid-specific EIIBC component Vibrio vulnificus (strain YJ016)
Q7A3G4 7.69e-21 100 39 1 143 1 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain N315)
Q99R97 7.69e-21 100 39 1 143 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain Mu50 / ATCC 700699)
A7X6P1 7.69e-21 100 39 1 143 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q8D4Z3 1.08e-20 99 24 15 490 3 murP PTS system N-acetylmuramic acid-specific EIIBC component Vibrio vulnificus (strain CMCP6)
P45604 1.27e-20 99 40 1 142 3 nagE PTS system N-acetylglucosamine-specific EIICBA component Klebsiella pneumoniae
Q48624 8.32e-20 97 35 2 162 3 lacS Lactose permease Leuconostoc lactis
Q9KVD9 1.73e-19 95 23 14 412 3 murP PTS system N-acetylmuramic acid-specific EIIBC component Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q7WTB2 4.33e-19 95 30 1 175 2 lacS Lactose permease Lactobacillus helveticus
P20166 9.82e-19 94 36 2 161 1 ptsG PTS system glucose-specific EIICBA component Bacillus subtilis (strain 168)
Q4L945 1.3e-18 93 32 2 180 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus haemolyticus (strain JCSC1435)
Q9WXI7 3.59e-18 85 35 1 131 3 crr PTS system glucose-specific EIIA component Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
P09323 1.06e-17 90 34 1 149 1 nagE PTS system N-acetylglucosamine-specific EIICBA component Escherichia coli (strain K12)
P45618 2.59e-17 82 34 1 131 1 crr PTS system glucose-specific EIIA component Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
Q8KA51 3.45e-17 82 34 0 123 3 crr PTS system glucose-specific EIIA component Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q89B05 1.08e-13 72 29 0 147 3 crr PTS system glucose-specific EIIA component Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P22733 6.89e-13 75 34 1 139 3 lacY Lactose permease Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
P47315 7.21e-10 65 30 7 155 3 ptsG PTS system glucose-specific EIICBA component Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P75569 4.32e-09 63 28 5 134 3 ptsG PTS system glucose-specific EIICBA component Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
O32292 8.79e-07 50 46 0 49 3 yyzE Putative phosphotransferase enzyme IIA component YyzE Bacillus subtilis (strain 168)
O06900 6.73e-05 49 29 0 81 4 malB PTS system alpha-glucoside-specific EIICB component Fusobacterium mortiferum
C7NB69 9.97e-05 48 33 1 80 3 Lebu_1527 PTS system alpha-glucoside-specific EIICB component Leptotrichia buccalis (strain ATCC 14201 / DSM 1135 / JCM 12969 / NCTC 10249 / C-1013-b)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS10970
Feature type CDS
Gene -
Product beta-glucoside-specific PTS transporter subunit IIABC
Location 2414701 - 2416590 (strand: -1)
Length 1890 (nucleotides) / 629 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_198
Orthogroup size 9
N. genomes 7

Actions

Genomic region

Domains

PF00358 phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 1
PF00367 phosphotransferase system, EIIB
PF02378 Phosphotransferase system, EIIC

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1263 Carbohydrate transport and metabolism (G) G Phosphotransferase system IIC components, glucose/maltose/N-acetylglucosamine-specific

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02757 beta-glucoside PTS system EIICBA component [EC:2.7.1.-] Phosphotransferase system (PTS) -

Protein Sequence

MNYKEFAKQILAIVGGEDNIKSLVHCSTRLRFTLHNEDKIDPSKAKANSKILSDVMKGGQYQLVIGNDVDKVFNELTKMIKTNNTPHDNNKDQKKQSIVNKILSAITGSIAPVIPLLAGAGMGKVLLIVLTMLGWLDKSDQTYYILNFIFNTAFYFMPVFIGFSAAKIFNCNQYLAAMVCLAMVSPEWTSLVKAGEPVEFMHIPVALVKYSSQLIPALITVWMMSYIERFIVRIVPEMVKVFMVPLLVILVSTPIALIAVGPVTSWFAQLIADGVILIQEHTGFIAIPLLVAIYPWLVSIGMHKALSPVSIMLVEQKGFDPIIRVMALCSNMSQAAASLAVSVRTKNKTLKQLAFSASITAFFGGITEPAMYGVNLKLKKPMYACMIGGAIAGLFAGIVKLKAFVYVTPGLLSLPMWISDTDNQVVNAIITLLIASVATFIATLIIGFDDPTDDPIRDEEENNKQAASTNKKPQIANSKLPVGLISPLQGKTVALSEVNDETFASGIMGPGMAIIPTTGKVIAPADGVVDITFSSGHAIGLTLVNNIEMLIHVGIDTVNLAGQHFTCCVVKGQKVTKGDTLIEFDLDAIIAAGYDPTTMIIITNDDNKLDVVQTDKKHVDQNTVLLTVG

Flanking regions ( +/- flanking 50bp)

TATCCATATATCTTTAATTTATTTTTACAGAATAAATAAAAGGCAATGCTATGAATTATAAAGAATTTGCAAAACAAATTCTCGCTATTGTTGGTGGCGAGGATAATATAAAGTCATTAGTACACTGCTCGACTCGATTACGTTTTACATTACATAATGAAGATAAAATTGATCCTTCAAAAGCCAAAGCAAATAGTAAAATATTATCTGATGTGATGAAGGGAGGACAATATCAACTGGTTATCGGTAATGATGTTGATAAAGTATTTAATGAACTAACAAAAATGATAAAAACAAATAATACTCCTCATGATAATAATAAAGACCAGAAGAAACAGTCTATCGTAAATAAAATATTATCAGCAATTACTGGCTCTATCGCTCCGGTTATCCCTCTGTTAGCGGGTGCCGGTATGGGGAAAGTGTTACTTATTGTATTAACGATGCTAGGTTGGTTGGATAAAAGTGACCAAACCTATTATATCCTTAACTTTATCTTTAATACGGCCTTCTATTTTATGCCGGTATTTATTGGTTTCTCGGCGGCGAAAATATTTAATTGTAACCAATATTTAGCTGCGATGGTCTGTTTAGCGATGGTCAGCCCTGAATGGACAAGCTTAGTTAAAGCCGGTGAGCCTGTCGAATTTATGCATATTCCTGTCGCTTTGGTTAAATATTCATCTCAACTGATCCCTGCTTTAATTACTGTTTGGATGATGTCTTATATAGAACGCTTTATTGTTCGTATTGTGCCAGAAATGGTTAAAGTATTTATGGTGCCTTTATTGGTGATTTTAGTTTCGACACCTATTGCGTTGATTGCGGTCGGTCCTGTCACTTCATGGTTCGCTCAATTAATTGCTGATGGGGTGATCTTAATCCAAGAGCACACCGGTTTTATTGCTATTCCATTATTAGTGGCTATTTATCCATGGTTAGTATCTATTGGTATGCATAAAGCACTTAGTCCTGTCAGTATTATGTTAGTGGAACAAAAAGGCTTTGATCCCATTATTCGTGTGATGGCGCTATGTTCTAATATGTCTCAGGCTGCTGCTTCTTTAGCTGTTTCTGTACGTACTAAAAACAAAACCTTAAAACAATTAGCTTTTTCTGCCAGTATTACCGCCTTTTTTGGTGGTATAACTGAACCCGCTATGTATGGGGTTAACCTCAAACTGAAAAAACCAATGTACGCTTGTATGATTGGTGGTGCTATTGCAGGATTATTTGCTGGTATTGTTAAGTTAAAAGCGTTCGTCTATGTCACTCCGGGGTTATTAAGTTTACCAATGTGGATATCTGATACAGATAACCAAGTGGTAAATGCAATAATCACCTTATTGATTGCCAGTGTAGCCACTTTTATTGCAACGCTTATTATTGGTTTTGATGATCCTACTGATGACCCAATCCGTGACGAAGAAGAAAATAATAAACAAGCTGCATCAACCAACAAAAAACCACAAATAGCGAATAGTAAATTACCTGTTGGGTTAATTTCACCTCTACAAGGTAAAACGGTTGCACTTTCAGAGGTTAATGATGAAACATTTGCTTCTGGCATTATGGGACCTGGCATGGCAATTATCCCCACAACAGGAAAAGTGATTGCACCTGCAGATGGCGTTGTTGATATTACCTTTTCTTCTGGTCATGCGATTGGCTTAACACTGGTTAACAATATTGAAATGCTGATCCATGTGGGGATTGATACCGTTAACTTAGCGGGACAGCACTTCACATGCTGTGTCGTTAAAGGTCAGAAGGTGACAAAAGGTGATACGCTAATTGAATTTGATTTAGATGCGATAATAGCCGCAGGCTATGATCCAACAACGATGATCATCATTACTAATGATGATAATAAGCTAGACGTTGTTCAGACCGATAAAAAACATGTCGACCAAAATACAGTTTTACTAACCGTGGGTTAAAACAATATGAATAACAAGCTTATGGTAACTAACGATTATTGCGCGACTAT