Homologs in group_198

Help

8 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_14490 EHELCC_14490 100.0 Morganella morganii S2 murP PTS N-acetylmuramic acid transporter subunit IIBC
NLDBIP_15585 NLDBIP_15585 100.0 Morganella morganii S4 murP PTS N-acetylmuramic acid transporter subunit IIBC
LHKJJB_15025 LHKJJB_15025 100.0 Morganella morganii S3 murP PTS N-acetylmuramic acid transporter subunit IIBC
HKOGLL_14145 HKOGLL_14145 100.0 Morganella morganii S5 murP PTS N-acetylmuramic acid transporter subunit IIBC
F4V73_RS14840 F4V73_RS14840 85.9 Morganella psychrotolerans murP PTS N-acetylmuramic acid transporter subunit IIBC
PMI_RS01405 PMI_RS01405 27.4 Proteus mirabilis HI4320 treB PTS trehalose transporter subunit IIBC
PMI_RS10970 PMI_RS10970 25.8 Proteus mirabilis HI4320 - beta-glucoside-specific PTS transporter subunit IIABC
PMI_RS17475 PMI_RS17475 37.7 Proteus mirabilis HI4320 - PTS transporter subunit EIIC

Distribution of the homologs in the orthogroup group_198

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_198

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N9D9 0.0 688 71 1 482 3 murP PTS system N-acetylmuramic acid-specific EIIBC component Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q5E5T6 0.0 668 69 1 484 3 murP PTS system N-acetylmuramic acid-specific EIIBC component Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q8D4Z3 0.0 658 68 2 487 3 murP PTS system N-acetylmuramic acid-specific EIIBC component Vibrio vulnificus (strain CMCP6)
Q7MBS2 0.0 657 68 2 487 3 murP PTS system N-acetylmuramic acid-specific EIIBC component Vibrio vulnificus (strain YJ016)
Q87FD5 0.0 655 68 3 485 3 murP PTS system N-acetylmuramic acid-specific EIIBC component Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q9KVD9 0.0 637 68 4 485 3 murP PTS system N-acetylmuramic acid-specific EIIBC component Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9CKN5 0.0 636 65 1 481 3 murP PTS system N-acetylmuramic acid-specific EIIBC component Pasteurella multocida (strain Pm70)
P77272 0.0 583 63 5 483 1 murP PTS system N-acetylmuramic acid-specific EIIBC component Escherichia coli (strain K12)
Q8FFA9 0.0 583 63 5 483 3 murP PTS system N-acetylmuramic acid-specific EIIBC component Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q83QN3 0.0 583 64 6 483 3 murP PTS system N-acetylmuramic acid-specific EIIBC component Shigella flexneri
Q1R8U3 0.0 582 63 5 483 3 murP PTS system N-acetylmuramic acid-specific EIIBC component Escherichia coli (strain UTI89 / UPEC)
Q8XBJ1 0.0 582 63 5 483 3 murP PTS system N-acetylmuramic acid-specific EIIBC component Escherichia coli O157:H7
Q31Y50 0.0 581 63 5 483 3 murP PTS system N-acetylmuramic acid-specific EIIBC component Shigella boydii serotype 4 (strain Sb227)
Q32DC5 0.0 578 63 5 483 3 murP PTS system N-acetylmuramic acid-specific EIIBC component Shigella dysenteriae serotype 1 (strain Sd197)
Q4L8H5 8.08e-86 275 38 12 483 3 SH0741 PTS system MurNAc-GlcNAc-specific EIIBC component Staphylococcus haemolyticus (strain JCSC1435)
Q797S1 5.88e-84 269 38 12 471 3 ybbF Putative PTS system EIIBC component YbbF Bacillus subtilis (strain 168)
Q2YV12 4.03e-82 265 37 14 486 3 SAB0132 PTS system MurNAc-GlcNAc-specific EIIBC component Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q6GKB4 1.79e-81 263 37 14 486 3 SAR0193 PTS system MurNAc-GlcNAc-specific EIIBC component Staphylococcus aureus (strain MRSA252)
Q7A1Y1 3.02e-81 263 37 12 485 3 MW0166 PTS system MurNAc-GlcNAc-specific EIIBC component Staphylococcus aureus (strain MW2)
Q6GCT4 3.02e-81 263 37 12 485 3 SAS0167 PTS system MurNAc-GlcNAc-specific EIIBC component Staphylococcus aureus (strain MSSA476)
Q7A804 3.02e-81 263 37 12 485 1 SA0186 PTS system MurNAc-GlcNAc-specific EIIBC component Staphylococcus aureus (strain N315)
Q99X29 3.02e-81 263 37 12 485 3 SAV0192 PTS system MurNAc-GlcNAc-specific EIIBC component Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HJI0 3.02e-81 263 37 12 485 3 SACOL0178 PTS system MurNAc-GlcNAc-specific EIIBC component Staphylococcus aureus (strain COL)
Q2G1G5 3.02e-81 263 37 12 485 3 SAOUHSC_00158 PTS system MurNAc-GlcNAc-specific EIIBC component Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FK70 3.02e-81 263 37 12 485 1 murP PTS system MurNAc-GlcNAc-specific EIIBC component Staphylococcus aureus (strain USA300)
Q49ZN7 3.05e-77 252 36 12 474 3 SSP0594 PTS system MurNAc-GlcNAc-specific EIIBC component Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q8CNB2 1.72e-74 245 36 10 474 3 SE_1890 PTS system MurNAc-GlcNAc-specific EIIBC component Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HLT2 1.72e-74 245 36 10 474 3 SERP1900 PTS system MurNAc-GlcNAc-specific EIIBC component Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P05306 1.62e-50 181 30 11 418 1 sacP PTS system sucrose-specific EIIBC component Bacillus subtilis (strain 168)
P22825 2.21e-46 171 29 13 491 3 scrA PTS system sucrose-specific EIIBC component Vibrio alginolyticus
P08470 1.06e-45 168 32 11 403 3 scrA PTS system sucrose-specific EIIBC component Salmonella typhimurium
Q9CJZ2 1.3e-45 168 29 15 490 3 scrA PTS system sucrose-specific EIIBC component Pasteurella multocida (strain Pm70)
P27219 1.68e-45 167 33 14 413 3 scrA PTS system sucrose-specific EIIBC component Klebsiella pneumoniae
P51184 5.23e-44 164 30 15 484 3 scrA PTS system sucrose-specific EIIBC component Staphylococcus xylosus
P08722 6.42e-41 158 28 12 436 1 bglF PTS system beta-glucoside-specific EIIBCA component Escherichia coli (strain K12)
Q9KF90 3.05e-39 153 30 11 432 3 bglP PTS system beta-glucoside-specific EIIBCA component Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P26207 9.03e-39 152 30 12 479 3 arbF PTS system beta-glucoside-specific EIIBCA component Dickeya chrysanthemi
P40739 4.63e-38 150 29 12 450 3 bglP PTS system beta-glucoside-specific EIIBCA component Bacillus subtilis (strain 168)
P39794 2.69e-36 143 28 14 468 2 treP PTS system trehalose-specific EIIBC component Bacillus subtilis (strain 168)
P15400 1.93e-35 140 26 10 405 1 sacX Probable PTS system sucrose-specific EIIBC component Bacillus subtilis (strain 168)
P36672 5.79e-35 139 24 8 432 1 treB PTS system trehalose-specific EIIBC component Escherichia coli (strain K12)
P12655 1.39e-33 137 28 12 420 1 scrA PTS system sucrose-specific EIIBCA component Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
P43470 5.57e-28 120 26 15 490 3 scrA PTS system sucrose-specific EIIBCA component Pediococcus pentosaceus
P24241 8.96e-25 110 25 9 427 3 ascF PTS system arbutin-, cellobiose-, and salicin-specific EIIBC component Escherichia coli (strain K12)
Q46072 4.74e-20 97 24 11 465 4 ptsM PTS system mannose-specific EIIBCA component Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q45298 4.93e-20 97 23 12 488 3 ptsG PTS system glucose-specific EIIBCA component Corynebacterium glutamicum
P20166 4e-07 56 29 3 108 1 ptsG PTS system glucose-specific EIICBA component Bacillus subtilis (strain 168)
Q4L945 2.07e-06 53 28 5 116 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus haemolyticus (strain JCSC1435)
Q57071 3.36e-06 53 31 3 98 1 ptsG PTS system glucose-specific EIICBA component Staphylococcus carnosus (strain TM300)
Q2YUZ1 8.68e-06 52 29 3 102 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q8NYM1 8.76e-06 52 29 3 102 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain MW2)
A8Z0F5 8.76e-06 52 29 3 102 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain USA300 / TCH1516)
Q6GCT7 8.76e-06 52 29 3 102 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain MSSA476)
Q6GKB7 8.76e-06 52 29 3 102 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain MRSA252)
Q7A807 8.76e-06 52 29 3 102 1 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain N315)
Q99X32 8.76e-06 52 29 3 102 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QDH3 8.76e-06 52 29 3 102 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain Newman)
Q5HJI3 8.76e-06 52 29 3 102 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain COL)
A5IP58 8.76e-06 52 29 3 102 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain JH9)
Q2G1G8 8.76e-06 52 29 3 102 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FK73 8.76e-06 52 29 3 102 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain USA300)
A6TXX3 8.76e-06 52 29 3 102 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain JH1)
A7WXI2 8.76e-06 52 29 3 102 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q7CCJ4 3.49e-05 50 27 3 100 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HL73 3.49e-05 50 27 3 100 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8VRH0 3.49e-05 50 27 3 100 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus epidermidis
Q2YWC1 3.97e-05 50 28 3 99 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q7A3G4 4.04e-05 50 28 3 99 1 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain N315)
Q99R97 4.04e-05 50 28 3 99 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain Mu50 / ATCC 700699)
A7X6P1 4.04e-05 50 28 3 99 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q6GDR0 4.25e-05 49 28 3 99 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain MRSA252)
Q8NUS2 4.33e-05 49 28 3 99 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain MW2)
A8Z3D6 4.33e-05 49 28 3 99 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain USA300 / TCH1516)
Q6G6D6 4.33e-05 49 28 3 99 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain MSSA476)
A6QK27 4.33e-05 49 28 3 99 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain Newman)
Q5HD13 4.33e-05 49 28 3 99 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain COL)
A5IVW5 4.33e-05 49 28 3 99 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain JH9)
Q2FV87 4.33e-05 49 28 3 99 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FDW8 4.33e-05 49 28 3 99 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain USA300)
A6U4R9 4.33e-05 49 28 3 99 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain JH1)
O34521 0.000141 47 39 2 68 1 nagP PTS system N-acetylglucosamine-specific EIICB component Bacillus subtilis (strain 168)
P69790 0.000164 45 38 2 68 3 glvB Phosphotransferase enzyme IIB component GlvB Shigella flexneri
P69789 0.000164 45 38 2 68 3 glvB Phosphotransferase enzyme IIB component GlvB Escherichia coli (strain K12)
P54715 0.000223 47 26 1 84 1 malP PTS system maltose-specific EIICB component Bacillus subtilis (strain 168)
P19642 0.000311 47 34 3 69 1 malX PTS system maltose-specific EIICB component Escherichia coli (strain K12)
P39816 0.000498 46 25 2 103 2 gamP PTS system glucosamine-specific EIICBA component Bacillus subtilis (strain 168)
P47315 0.000657 46 28 1 106 3 ptsG PTS system glucose-specific EIICBA component Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P35595 0.000803 45 27 2 107 3 exp5 PTS system glucose-specific EIICBA component Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_11815
Feature type CDS
Gene murP
Product PTS N-acetylmuramic acid transporter subunit IIBC
Location 14449 - 15894 (strand: 1)
Length 1446 (nucleotides) / 481 (amino acids)

Contig

Accession contig_14
Length 134564 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_198
Orthogroup size 9
N. genomes 7

Actions

Genomic region

Domains

PF00367 phosphotransferase system, EIIB
PF02378 Phosphotransferase system, EIIC

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1263 Carbohydrate transport and metabolism (G) G Phosphotransferase system IIC components, glucose/maltose/N-acetylglucosamine-specific

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K11192 N-acetylmuramic acid PTS system EIICB component [EC:2.7.1.192] Amino sugar and nucleotide sugar metabolism
Phosphotransferase system (PTS)		 -

Protein Sequence

MAKISQSTIIQILDAIGGPGNVAQSGNCMTRLRLTLNNTQLADKIAIKKIEGVLGVIESDEQFQIVLGPGKAQTAAELMQKYLDEHVPGSEPDSRSLKEIAADQKQHLKEKQTNPVQRFLAKFATIFTPLIPGFIGVGLLLGFATLFESLWVTGNPSPNSTLVEVLSYMKVFGKGLFTFMGILIGYNAQKAFGGSGVNGAIIAALFILGYDPQATKGFYSGMETFFGHGIDPRGNIIGILIATITGAWVERQVRRFIPANLDIILTSAITLLIMGALTFIVIMPVGVWLFDGMSWLFMHLNANPFGAAVLAGLFLIAVMFGIHQGFIPVYTALVGTQGFNSLFPILAMAGAGQVGAALALYVRAKKDSVLRNQIRGAIIPGFLGIGEPLIYGVTLPRVKPFITACCGGAAGGFFIGLVAWFGYPVGLNTVFGPSGIIAIPVMTSDSGIFMGMAVYTGGLLVAYLAGFLFTLLFGSKNVDLS

Flanking regions ( +/- flanking 50bp)

TCCGTGACGCGCTGACCGGCGCGGCGCACTCTTAACGCAAGGTAATCACCATGGCCAAAATCAGTCAGTCAACCATCATACAGATTCTGGATGCCATCGGCGGTCCGGGTAACGTGGCACAGAGCGGTAACTGTATGACCCGCCTGCGTCTGACACTGAACAACACACAGCTGGCGGATAAAATCGCCATCAAAAAAATTGAGGGCGTGCTGGGTGTGATTGAAAGTGATGAGCAGTTCCAGATTGTGCTGGGGCCGGGCAAAGCACAAACCGCCGCAGAGCTGATGCAGAAATATCTGGATGAGCATGTACCGGGCAGTGAACCGGACAGCCGCAGCCTGAAAGAGATTGCCGCTGATCAGAAGCAGCATCTGAAAGAAAAACAGACAAATCCGGTACAGCGTTTTCTCGCCAAATTCGCCACTATTTTTACCCCGCTCATTCCCGGGTTTATCGGCGTGGGTCTGCTGCTCGGCTTTGCCACACTATTTGAATCGCTCTGGGTCACCGGAAATCCGTCCCCGAACAGCACACTGGTGGAAGTGCTCAGTTACATGAAGGTCTTCGGCAAAGGGCTGTTTACCTTTATGGGGATCCTGATCGGCTATAACGCGCAGAAAGCCTTCGGCGGATCCGGTGTCAATGGTGCGATCATCGCGGCACTGTTTATCCTCGGTTATGATCCGCAGGCGACCAAAGGTTTCTACTCCGGTATGGAAACGTTCTTCGGTCACGGCATTGACCCGCGCGGTAATATTATCGGGATTCTGATCGCCACCATCACCGGTGCATGGGTGGAACGGCAGGTGCGGCGTTTTATCCCTGCTAACCTGGATATCATTCTGACCTCCGCCATCACCCTGCTGATTATGGGCGCACTGACCTTTATTGTGATTATGCCGGTCGGCGTCTGGCTGTTTGACGGCATGTCCTGGCTGTTTATGCACCTTAACGCTAACCCGTTCGGCGCTGCTGTTCTCGCCGGTCTGTTCCTGATAGCGGTGATGTTTGGTATCCACCAGGGCTTTATCCCGGTGTATACCGCGCTGGTCGGCACTCAGGGTTTTAACTCCCTGTTCCCGATCCTCGCCATGGCGGGTGCCGGTCAGGTCGGTGCTGCGCTGGCACTGTATGTCCGCGCGAAAAAAGACTCGGTGCTGCGTAATCAAATCCGGGGAGCAATTATCCCGGGCTTCCTCGGCATCGGCGAACCGCTGATCTACGGCGTGACCCTGCCGCGCGTGAAGCCGTTTATCACTGCCTGCTGCGGCGGTGCAGCCGGCGGGTTCTTTATCGGGCTTGTCGCCTGGTTCGGCTATCCGGTCGGGCTGAATACTGTTTTCGGGCCATCGGGGATTATCGCCATTCCGGTGATGACATCCGACAGTGGTATCTTCATGGGGATGGCGGTCTATACCGGCGGGTTACTCGTCGCCTATCTGGCCGGATTCCTGTTTACCCTGCTGTTCGGCAGTAAGAATGTGGATTTAAGCTGATTTCGCTGCATTGATAAAAAAAACAGACCGCAATGCGGTCTGTTTTTCAT