Homologs in group_3648

Help

4 homologs were identified in 2 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
F4V73_RS17005 F4V73_RS17005 62.2 Morganella psychrotolerans cueR Cu(I)-responsive transcriptional regulator
F4V73_RS17030 F4V73_RS17030 31.0 Morganella psychrotolerans - MerR family transcriptional regulator
PMI_RS13330 PMI_RS13330 26.9 Proteus mirabilis HI4320 soxR redox-sensitive transcriptional activator SoxR
PMI_RS18275 PMI_RS18275 27.9 Proteus mirabilis HI4320 - MerR family transcriptional regulator

Distribution of the homologs in the orthogroup group_3648

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3648

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P58379 1.07e-56 176 63 0 126 3 hmrR2 Heavy metal-dependent transcription regulator 2 Rhizobium meliloti (strain 1021)
Q9X5X4 2.43e-56 175 63 0 128 1 hmrR HTH-type transcriptional regulator HmrR Sinorhizobium medicae (strain WSM419)
P58378 5.68e-52 164 58 1 133 3 hmrR1 Heavy metal-dependent transcription regulator 1 Rhizobium meliloti (strain 1021)
Q9HV30 3.59e-47 151 55 0 127 3 PA4778 Uncharacterized HTH-type transcriptional regulator PA4778 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9X5V4 8.39e-40 132 49 1 126 4 hmrR HTH-type transcriptional regulator HmrR Rhizobium leguminosarum bv. viciae
P44617 3.41e-39 131 49 0 126 3 HI_0293 Probable heavy metal-dependent transcriptional regulator HI_0293 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q93CH6 1.1e-31 112 42 0 126 1 cueR HTH-type transcriptional regulator CueR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8ZCA8 1.38e-31 112 42 0 126 3 cueR HTH-type transcriptional regulator CueR Yersinia pestis
Q8Z8S3 2.44e-31 111 41 0 126 3 cueR HTH-type transcriptional regulator CueR Salmonella typhi
Q8XD09 7.08e-30 107 41 0 126 3 cueR HTH-type transcriptional regulator CueR Escherichia coli O157:H7
P0A9G5 7.98e-30 107 41 0 126 3 cueR HTH-type transcriptional regulator CueR Shigella flexneri
P0A9G4 7.98e-30 107 41 0 126 1 cueR HTH-type transcriptional regulator CueR Escherichia coli (strain K12)
Q8FK74 3.39e-29 106 40 0 126 3 cueR HTH-type transcriptional regulator CueR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0C6D2 1.48e-26 99 40 0 126 3 cueR HTH-type transcriptional regulator CueR Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F2W6 1.48e-26 99 40 0 126 3 cueR HTH-type transcriptional regulator CueR Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
P22853 3.78e-23 90 36 1 127 1 merR1 Mercuric resistance operon regulatory protein Bacillus cereus
P0ACS5 1.65e-21 86 35 2 135 1 zntR HTH-type transcriptional regulator ZntR Escherichia coli (strain K12)
P0ACS6 1.65e-21 86 35 2 135 3 zntR HTH-type transcriptional regulator ZntR Escherichia coli O157:H7
P22896 2.54e-19 80 38 0 113 4 merR Mercuric resistance operon regulatory protein (Fragment) Acidithiobacillus ferrooxidans
P13111 2.56e-17 75 32 2 127 4 merR Mercuric resistance operon regulatory protein Serratia marcescens
P22874 1.46e-16 73 31 1 128 4 merR Mercuric resistance operon regulatory protein Staphylococcus aureus
P69413 2.39e-16 73 32 2 127 3 merR Mercuric resistance operon regulatory protein Pseudomonas sp.
P0A184 2.39e-16 73 32 2 127 3 merR Mercuric resistance operon regulatory protein Pseudomonas fluorescens
P0A183 2.39e-16 73 32 2 127 1 merR Mercuric resistance operon regulatory protein Pseudomonas aeruginosa
O06008 9.47e-16 72 36 1 108 1 adhR HTH-type transcriptional regulator AdhR Bacillus subtilis (strain 168)
P45277 1e-15 71 34 1 119 3 zntR HTH-type transcriptional regulator ZntR homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0A2Q9 1.85e-15 71 31 2 127 4 merR Mercuric resistance operon regulatory protein Shigella flexneri
P0A2Q8 1.85e-15 71 31 2 127 3 merR Mercuric resistance operon regulatory protein Salmonella typhi
Q55963 1.97e-15 70 28 1 128 4 slr0701 Uncharacterized HTH-type transcriptional regulator slr0701 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
O06474 5.1e-13 64 36 3 108 2 yfmP HTH-type transcriptional regulator YfmP Bacillus subtilis (strain 168)
P37510 4.88e-12 62 28 1 132 4 yyaN Uncharacterized HTH-type transcriptional regulator YyaN Bacillus subtilis (strain 168)
P0A4T9 2.58e-09 56 26 2 132 1 tipA HTH-type transcriptional activator TipA Streptomyces lividans
P0A4T8 2.58e-09 56 26 2 132 3 tipA HTH-type transcriptional activator TipA Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P50329 7.7e-08 52 38 0 62 4 nolA Nodulation protein NolA (Fragment) Bradyrhizobium elkanii
P50330 2.28e-07 51 37 0 61 4 nolA Nodulation protein NolA Bradyrhizobium sp. (strain NC92)
P71039 1.21e-06 49 29 1 103 1 mta HTH-type transcriptional activator mta Bacillus subtilis (strain 168)
P22537 1.35e-05 46 36 0 61 2 nolA Nodulation protein NolA Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
P44558 0.000713 40 31 0 60 1 HI_0186 Uncharacterized HTH-type transcriptional regulator HI_0186 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P96690 0.000829 41 25 3 130 4 ydfL Uncharacterized HTH-type transcriptional regulator YdfL Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS10150
Feature type CDS
Gene cueR
Product Cu(I)-responsive transcriptional regulator
Location 2222564 - 2222971 (strand: 1)
Length 408 (nucleotides) / 135 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_3648
Orthogroup size 5
N. genomes 2

Actions

Genomic region

Domains

PF00376 MerR family regulatory protein
PF09278 MerR, DNA binding

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0789 Transcription (K) K DNA-binding transcriptional regulator, MerR family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K19591 MerR family transcriptional regulator, copper efflux regulator - Multidrug resistance, efflux pump MexPQ-OpmE

Protein Sequence

MNIGQAAKKSGISSKMIRYYEQIGLIPKAIRTDGGYRDYNDSDVDCFRFIRHSRALGFSTEQISTLLVLWNNRERTSADVKAIALSHIDELNRKIAQLQRMTQTLSHLAQECQGDNNPDCPIIAKLVEPQTGTEH

Flanking regions ( +/- flanking 50bp)

TTATCTCTACTTAGAAGAAAAGCGCTTTATTATCAGATAAGGAGAATAAGATGAATATTGGTCAAGCTGCAAAAAAATCCGGTATTTCAAGTAAAATGATCCGATATTATGAGCAAATTGGTTTAATACCTAAGGCAATTCGTACTGACGGAGGTTATCGCGATTACAATGATAGCGATGTAGATTGTTTTCGCTTTATCCGCCATTCACGTGCTCTTGGTTTTTCAACAGAGCAAATATCAACATTATTAGTTTTATGGAATAACAGAGAACGGACAAGTGCTGATGTAAAAGCTATTGCCCTTTCTCATATCGATGAATTAAACCGTAAAATAGCGCAATTGCAACGAATGACGCAAACATTATCGCATTTAGCACAAGAGTGCCAAGGTGATAATAATCCTGATTGCCCAATTATTGCTAAGCTAGTCGAACCCCAAACAGGGACAGAACATTAAACAACAAAAAAACAACCTTTATTACCTCCACTCTCCTATTTTATGGTTTT