Homologs in group_842

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04255 FBDBKF_04255 37.7 Morganella morganii S1 ppdD prepilin peptidase-dependent pilin
EHELCC_05545 EHELCC_05545 37.7 Morganella morganii S2 ppdD prepilin peptidase-dependent pilin
NLDBIP_05865 NLDBIP_05865 37.7 Morganella morganii S4 ppdD prepilin peptidase-dependent pilin
LHKJJB_02745 LHKJJB_02745 37.7 Morganella morganii S3 ppdD prepilin peptidase-dependent pilin
HKOGLL_06220 HKOGLL_06220 37.7 Morganella morganii S5 ppdD prepilin peptidase-dependent pilin
F4V73_RS08700 F4V73_RS08700 41.3 Morganella psychrotolerans ppdD prepilin peptidase-dependent pilin

Distribution of the homologs in the orthogroup group_842

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_842

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P36647 1.72e-41 138 46 2 138 1 ppdD Prepilin peptidase-dependent protein D Escherichia coli (strain K12)
P02974 5.86e-16 73 38 2 102 1 pilE1 Type IV major pilin protein PilE1 Neisseria gonorrhoeae
Q00046 1.34e-15 72 38 2 102 3 pilE1 Type IV major pilin protein PilE1 Neisseria gonorrhoeae
P05431 4.24e-14 68 37 3 103 1 pilE Fimbrial protein Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P57039 2.03e-13 67 38 3 102 1 pilE Fimbrial protein Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
P44623 8.96e-13 64 33 4 141 3 ppdD Prepilin peptidase-dependent protein D homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P11764 1.43e-12 64 36 3 103 3 pilE Type IV major pilin protein PilE Neisseria gonorrhoeae
Q00045 1.76e-12 65 35 2 106 3 pilE1 Type IV major pilin protein PilE1 Neisseria gonorrhoeae
P17416 2.67e-08 53 39 1 71 3 fimZ Probable minor fimbrial protein Dichelobacter nodosus
P02975 5.95e-08 52 40 2 70 1 fimA Type IV major fimbrial protein FimA Dichelobacter nodosus
P17417 6.77e-08 52 39 1 71 3 fimZ Probable minor fimbrial protein Dichelobacter nodosus
P27691 1.24e-07 51 36 2 86 3 fimA Fimbrial protein Dichelobacter nodosus
P27690 1.55e-07 51 59 0 37 3 fimA Fimbrial protein Dichelobacter nodosus
P17822 1.6e-07 51 59 0 37 3 fimA Type IV major fimbrial protein FimA Dichelobacter nodosus
P27689 1.68e-07 51 59 0 37 3 fimA Type IV major fimbrial protein FimA Dichelobacter nodosus
P17824 1.7e-07 50 53 0 41 3 fimA Type IV major fimbrial protein FimA Dichelobacter nodosus
P27688 1.76e-07 50 59 0 37 3 fimA Type IV major fimbrial protein FimA Dichelobacter nodosus
P17823 1.81e-07 50 53 0 41 1 fimA Type IV major fimbrial protein FimA Dichelobacter nodosus
P17827 1.88e-07 50 59 0 37 3 fimA Type IV major fimbrial protein FimA Dichelobacter nodosus
P27906 1.94e-07 50 59 0 37 3 fimA Type IV major fimbrial protein FimA Dichelobacter nodosus
P17825 1.96e-07 50 59 0 37 3 fimA Fimbrial protein Dichelobacter nodosus
P17826 2.25e-07 50 59 0 37 3 fimA Type IV major fimbrial protein FimA Dichelobacter nodosus
P11933 2.62e-07 50 53 0 41 3 fimA Type IV major fimbrial protein FimA Dichelobacter nodosus
A5EWR9 2.62e-07 50 53 0 41 2 fimA Type IV major fimbrial protein FimA Dichelobacter nodosus (strain VCS1703A)
G3XD43 2.13e-05 45 38 0 47 1 pilE Type IV pilus non-core minor pilin PilE Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P19528 5.76e-05 44 40 1 72 3 fimA Type IV major fimbrial protein FimA Dichelobacter nodosus
P04953 6.93e-05 43 40 0 64 1 fimA Type IV major fimbrial protein FimA Dichelobacter nodosus
P13253 7.59e-05 43 42 0 61 3 fimA Type IV major fimbrial protein FimA Dichelobacter nodosus
P36643 7.62e-05 43 40 0 52 3 pilA Fimbrial protein Pseudomonas putida
A0A0H3HDD6 0.00016 42 31 0 60 1 KOX_13580 Type II secretion system core protein G Klebsiella michiganensis (strain ATCC 8724 / DSM 4798 / JCM 20051 / NBRC 3318 / NRRL B-199 / KCTC 1686 / BUCSAV 143 / CCM 1901)
P15746 0.000355 41 31 0 57 1 pulG Type II secretion system core protein G Klebsiella pneumoniae
P07640 0.000653 41 48 0 58 1 tfpQ Fimbrial protein Q Moraxella bovis
P17837 0.001 40 47 0 51 3 pilA Fimbrial protein Pseudomonas aeruginosa
P31586 0.001 40 29 0 57 3 outG Type II secretion system core protein G Pectobacterium carotovorum subsp. carotovorum

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS10100
Feature type CDS
Gene ppdD
Product prepilin peptidase-dependent pilin
Location 2207345 - 2207788 (strand: 1)
Length 444 (nucleotides) / 147 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_842
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF07963 Prokaryotic N-terminal methylation motif

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4969 Cell motility (N)
Extracellular structures (W)		 NW Type IV pilus assembly protein, major pilin PilA

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02682 prepilin peptidase dependent protein D - -

Protein Sequence

MNTLNYHSTENGFTLMELMIVIAIISILSSVAIPAYHGYIQKAALTDVLQTLSPYRSAVELCHYEHQYNQCHADASFMPQQFRSRYLTDIHVANGVISAKGKAQLEGLTIVMTPAANSKETLPQWQINCTSTNTALQTLCHKVFKSH

Flanking regions ( +/- flanking 50bp)

AAAACGCTTTTTTCTCATACTTCAATAGGTTATTTATCAAGGAGAGAAAAATGAATACATTAAATTATCACTCAACAGAGAATGGATTCACGCTAATGGAATTGATGATTGTGATTGCCATTATCTCAATTTTAAGCTCAGTGGCGATCCCTGCTTATCATGGTTATATCCAAAAAGCCGCCTTAACTGATGTATTACAAACCCTGTCGCCTTATCGTTCTGCAGTGGAACTTTGTCACTATGAACATCAATATAACCAATGCCATGCTGATGCCAGTTTTATGCCTCAACAATTTCGTAGTCGATACCTTACTGATATTCATGTTGCCAATGGCGTTATTAGTGCAAAAGGTAAGGCTCAACTAGAAGGACTAACCATCGTAATGACTCCTGCAGCAAACAGCAAAGAGACACTTCCCCAATGGCAAATTAACTGCACATCAACTAACACTGCGTTACAAACGCTATGCCATAAGGTTTTTAAATCTCATTAAACCAATCTAACGACAACCTCAACCAAGGTGGAAAAGCCAATAGGCTCTGT