Homologs in group_842

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04255 FBDBKF_04255 100.0 Morganella morganii S1 ppdD prepilin peptidase-dependent pilin
EHELCC_05545 EHELCC_05545 100.0 Morganella morganii S2 ppdD prepilin peptidase-dependent pilin
NLDBIP_05865 NLDBIP_05865 100.0 Morganella morganii S4 ppdD prepilin peptidase-dependent pilin
HKOGLL_06220 HKOGLL_06220 100.0 Morganella morganii S5 ppdD prepilin peptidase-dependent pilin
F4V73_RS08700 F4V73_RS08700 77.0 Morganella psychrotolerans ppdD prepilin peptidase-dependent pilin
PMI_RS10100 PMI_RS10100 37.7 Proteus mirabilis HI4320 ppdD prepilin peptidase-dependent pilin

Distribution of the homologs in the orthogroup group_842

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_842

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P36647 1.53e-42 140 47 1 138 1 ppdD Prepilin peptidase-dependent protein D Escherichia coli (strain K12)
P44623 1.14e-18 79 40 2 130 3 ppdD Prepilin peptidase-dependent protein D homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q00046 1.37e-18 80 40 1 98 3 pilE1 Type IV major pilin protein PilE1 Neisseria gonorrhoeae
P05431 7.79e-18 78 32 3 125 1 pilE Fimbrial protein Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P02974 1.12e-16 75 31 4 136 1 pilE1 Type IV major pilin protein PilE1 Neisseria gonorrhoeae
P57039 1.28e-16 75 30 4 140 1 pilE Fimbrial protein Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
P11764 1.38e-16 74 39 1 97 3 pilE Type IV major pilin protein PilE Neisseria gonorrhoeae
Q00045 4.85e-14 69 38 1 96 3 pilE1 Type IV major pilin protein PilE1 Neisseria gonorrhoeae
P02975 1.2e-09 56 34 0 78 1 fimA Type IV major fimbrial protein FimA Dichelobacter nodosus
P27906 6.23e-09 54 33 0 78 3 fimA Type IV major fimbrial protein FimA Dichelobacter nodosus
P17826 2.37e-08 53 33 0 78 3 fimA Type IV major fimbrial protein FimA Dichelobacter nodosus
P17824 2.42e-08 53 32 0 78 3 fimA Type IV major fimbrial protein FimA Dichelobacter nodosus
P17825 2.48e-08 53 33 0 78 3 fimA Fimbrial protein Dichelobacter nodosus
P17416 2.64e-08 52 32 1 94 3 fimZ Probable minor fimbrial protein Dichelobacter nodosus
P17823 7.65e-08 51 31 2 82 1 fimA Type IV major fimbrial protein FimA Dichelobacter nodosus
P17822 7.89e-08 51 35 3 84 3 fimA Type IV major fimbrial protein FimA Dichelobacter nodosus
P36643 1.16e-07 50 43 0 53 3 pilA Fimbrial protein Pseudomonas putida
P11933 1.4e-07 51 31 4 107 3 fimA Type IV major fimbrial protein FimA Dichelobacter nodosus
A5EWR9 1.4e-07 51 31 4 107 2 fimA Type IV major fimbrial protein FimA Dichelobacter nodosus (strain VCS1703A)
P04953 2.01e-07 50 44 0 63 1 fimA Type IV major fimbrial protein FimA Dichelobacter nodosus
P13253 2.49e-07 50 44 0 63 3 fimA Type IV major fimbrial protein FimA Dichelobacter nodosus
P17417 2.66e-07 50 29 2 122 3 fimZ Probable minor fimbrial protein Dichelobacter nodosus
P27690 2.84e-07 50 55 0 34 3 fimA Fimbrial protein Dichelobacter nodosus
P27688 3.12e-07 50 55 0 34 3 fimA Type IV major fimbrial protein FimA Dichelobacter nodosus
P27691 3.35e-07 50 55 0 34 3 fimA Fimbrial protein Dichelobacter nodosus
P27689 3.36e-07 50 55 0 34 3 fimA Type IV major fimbrial protein FimA Dichelobacter nodosus
P17827 3.5e-07 50 55 0 34 3 fimA Type IV major fimbrial protein FimA Dichelobacter nodosus
P19528 5.06e-07 49 44 0 63 3 fimA Type IV major fimbrial protein FimA Dichelobacter nodosus
P31585 7.29e-07 48 31 0 70 3 outG Type II secretion system core protein G Dickeya chrysanthemi
A0A0H3HDD6 1.16e-06 48 31 0 67 1 KOX_13580 Type II secretion system core protein G Klebsiella michiganensis (strain ATCC 8724 / DSM 4798 / JCM 20051 / NBRC 3318 / NRRL B-199 / KCTC 1686 / BUCSAV 143 / CCM 1901)
G3XD43 1.96e-06 47 58 0 31 1 pilE Type IV pilus non-core minor pilin PilE Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P15746 2.32e-06 47 33 0 66 1 pulG Type II secretion system core protein G Klebsiella pneumoniae
P17838 2.79e-06 47 32 3 134 1 pilA Fimbrial protein Pseudomonas aeruginosa
P31586 5.35e-06 46 30 0 66 3 outG Type II secretion system core protein G Pectobacterium carotovorum subsp. carotovorum
P04739 1.06e-05 45 52 0 51 1 pilA Type IV major pilin protein PilA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P17837 1.16e-05 45 52 0 51 3 pilA Fimbrial protein Pseudomonas aeruginosa
P08015 1.23e-05 45 52 0 51 3 pilA Fimbrial protein Pseudomonas aeruginosa
P02973 1.89e-05 45 52 0 51 1 pilA Fimbrial protein Pseudomonas aeruginosa
P31733 5.82e-05 43 30 0 66 3 exeG Type II secretion system core protein G Aeromonas hydrophila
P45791 6.83e-05 43 45 0 71 3 tapA Type IV pilus subunit protein TapA Aeromonas hydrophila
P17836 9.83e-05 43 49 0 51 3 pilA Fimbrial protein Pseudomonas aeruginosa
P18774 0.0001 43 49 0 51 1 pilA Fimbrial protein Pseudomonas aeruginosa
P07640 0.000156 42 49 1 59 1 tfpQ Fimbrial protein Q Moraxella bovis
P45773 0.000158 42 31 0 66 1 epsG Type II secretion system core protein G Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P20657 0.000285 42 49 1 59 1 tfpI Type IV major alpha-pilin Moraxella bovis
Q00514 0.000305 41 31 0 67 1 xcpT Type II secretion system core protein G Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_02745
Feature type CDS
Gene ppdD
Product prepilin peptidase-dependent pilin
Location 117470 - 117889 (strand: 1)
Length 420 (nucleotides) / 139 (amino acids)

Contig

Accession ZDB_360
Length 302856 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_842
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF07963 Prokaryotic N-terminal methylation motif

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4969 Cell motility (N)
Extracellular structures (W)		 NW Type IV pilus assembly protein, major pilin PilA

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02682 prepilin peptidase dependent protein D - -

Protein Sequence

MNQRGFTLIEVMVVVAIVAVLSAIAVPGYQNYIRKAALIDVLRTVTAFKTGVELCSFDNPSFAGCNSGSGTIPADTPGRYIKSVKAENGVVTVQGNSSLAALTVSTTPVRNPLNGITVWTTDCNSEEDALKKICLDVIK

Flanking regions ( +/- flanking 50bp)

CATCACGCTAAATAAGTACCTCTTTCACAGACACAAAAAGGAGCATCTGTATGAACCAGCGCGGATTCACATTAATCGAGGTGATGGTGGTGGTTGCCATTGTGGCCGTTCTCAGTGCCATCGCGGTTCCCGGCTATCAGAACTATATCCGGAAGGCAGCACTGATTGACGTGCTGCGCACGGTTACCGCGTTTAAAACCGGCGTGGAACTGTGCAGTTTTGATAATCCCTCTTTTGCAGGATGCAACAGCGGGTCGGGCACCATTCCGGCTGATACTCCGGGGCGCTACATCAAATCCGTCAAAGCGGAAAACGGTGTTGTGACGGTACAGGGAAACAGTTCACTGGCTGCGCTGACGGTCAGCACTACCCCGGTAAGAAATCCGCTTAACGGTATCACGGTCTGGACAACCGACTGTAACAGCGAAGAAGACGCACTGAAAAAAATCTGTCTTGACGTCATCAAGTAACTACTGACATGAAAAGGAATTCATTATGCAAACAGCTGCACCCGCCCCTG