Homologs in group_911

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04255 FBDBKF_04255 77.0 Morganella morganii S1 ppdD prepilin peptidase-dependent pilin
EHELCC_05545 EHELCC_05545 77.0 Morganella morganii S2 ppdD prepilin peptidase-dependent pilin
NLDBIP_05865 NLDBIP_05865 77.0 Morganella morganii S4 ppdD prepilin peptidase-dependent pilin
LHKJJB_02745 LHKJJB_02745 77.0 Morganella morganii S3 ppdD prepilin peptidase-dependent pilin
HKOGLL_06220 HKOGLL_06220 77.0 Morganella morganii S5 ppdD prepilin peptidase-dependent pilin
PMI_RS10100 PMI_RS10100 41.3 Proteus mirabilis HI4320 ppdD prepilin peptidase-dependent pilin

Distribution of the homologs in the orthogroup group_911

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_911

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P36647 1.47e-38 130 44 1 138 1 ppdD Prepilin peptidase-dependent protein D Escherichia coli (strain K12)
P44623 3.46e-18 78 38 2 130 3 ppdD Prepilin peptidase-dependent protein D homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q00046 4.46e-16 73 32 2 122 3 pilE1 Type IV major pilin protein PilE1 Neisseria gonorrhoeae
P11764 2.34e-15 71 36 1 97 3 pilE Type IV major pilin protein PilE Neisseria gonorrhoeae
P05431 1.3e-13 67 32 1 97 1 pilE Fimbrial protein Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P02974 2.88e-13 66 33 1 93 1 pilE1 Type IV major pilin protein PilE1 Neisseria gonorrhoeae
P57039 1.4e-12 64 32 1 97 1 pilE Fimbrial protein Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q00045 9.02e-12 63 31 1 97 3 pilE1 Type IV major pilin protein PilE1 Neisseria gonorrhoeae
P02975 4e-09 55 34 1 86 1 fimA Type IV major fimbrial protein FimA Dichelobacter nodosus
P17416 8.42e-09 54 43 0 55 3 fimZ Probable minor fimbrial protein Dichelobacter nodosus
P27906 1.71e-08 53 34 0 78 3 fimA Type IV major fimbrial protein FimA Dichelobacter nodosus
P17824 2.32e-08 53 33 0 78 3 fimA Type IV major fimbrial protein FimA Dichelobacter nodosus
P17417 4.26e-08 52 41 0 55 3 fimZ Probable minor fimbrial protein Dichelobacter nodosus
P17825 4.35e-08 52 34 0 78 3 fimA Fimbrial protein Dichelobacter nodosus
P17826 6.49e-08 52 34 0 78 3 fimA Type IV major fimbrial protein FimA Dichelobacter nodosus
P17823 8.57e-08 51 33 1 84 1 fimA Type IV major fimbrial protein FimA Dichelobacter nodosus
P17822 3.28e-07 50 32 1 79 3 fimA Type IV major fimbrial protein FimA Dichelobacter nodosus
P04953 5.41e-07 49 46 0 63 1 fimA Type IV major fimbrial protein FimA Dichelobacter nodosus
P27690 5.9e-07 49 55 0 34 3 fimA Fimbrial protein Dichelobacter nodosus
P27689 6.5e-07 49 55 0 34 3 fimA Type IV major fimbrial protein FimA Dichelobacter nodosus
P27688 6.61e-07 49 55 0 34 3 fimA Type IV major fimbrial protein FimA Dichelobacter nodosus
P17827 7.2e-07 49 55 0 34 3 fimA Type IV major fimbrial protein FimA Dichelobacter nodosus
P13253 7.37e-07 48 46 0 63 3 fimA Type IV major fimbrial protein FimA Dichelobacter nodosus
P27691 7.4e-07 48 55 0 34 3 fimA Fimbrial protein Dichelobacter nodosus
P11933 7.45e-07 48 57 0 33 3 fimA Type IV major fimbrial protein FimA Dichelobacter nodosus
A5EWR9 7.45e-07 48 57 0 33 2 fimA Type IV major fimbrial protein FimA Dichelobacter nodosus (strain VCS1703A)
P36643 1.12e-06 48 41 0 53 3 pilA Fimbrial protein Pseudomonas putida
P19528 1.63e-06 48 50 0 56 3 fimA Type IV major fimbrial protein FimA Dichelobacter nodosus
G3XD43 2.81e-06 47 58 0 31 1 pilE Type IV pilus non-core minor pilin PilE Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P02973 1.34e-05 45 33 2 133 1 pilA Fimbrial protein Pseudomonas aeruginosa
P31585 3.44e-05 44 28 0 70 3 outG Type II secretion system core protein G Dickeya chrysanthemi
A0A0H3HDD6 3.81e-05 44 28 0 67 1 KOX_13580 Type II secretion system core protein G Klebsiella michiganensis (strain ATCC 8724 / DSM 4798 / JCM 20051 / NBRC 3318 / NRRL B-199 / KCTC 1686 / BUCSAV 143 / CCM 1901)
P04739 4.58e-05 43 50 0 51 1 pilA Type IV major pilin protein PilA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P08015 5.14e-05 43 50 0 51 3 pilA Fimbrial protein Pseudomonas aeruginosa
P17837 5.19e-05 43 50 0 51 3 pilA Fimbrial protein Pseudomonas aeruginosa
P15746 8.07e-05 43 30 0 66 1 pulG Type II secretion system core protein G Klebsiella pneumoniae
P31586 0.000124 43 27 0 66 3 outG Type II secretion system core protein G Pectobacterium carotovorum subsp. carotovorum
P45773 0.000145 42 30 0 66 1 epsG Type II secretion system core protein G Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P31733 0.000221 42 28 0 66 3 exeG Type II secretion system core protein G Aeromonas hydrophila
P45791 0.000352 41 40 0 87 3 tapA Type IV pilus subunit protein TapA Aeromonas hydrophila
P17836 0.000381 41 49 0 51 3 pilA Fimbrial protein Pseudomonas aeruginosa
P18774 0.000397 41 49 0 51 1 pilA Fimbrial protein Pseudomonas aeruginosa
P07640 0.000527 41 42 2 77 1 tfpQ Fimbrial protein Q Moraxella bovis
Q00514 0.000709 40 33 1 68 1 xcpT Type II secretion system core protein G Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P20657 0.001 40 47 2 65 1 tfpI Type IV major alpha-pilin Moraxella bovis

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS08700
Feature type CDS
Gene ppdD
Product prepilin peptidase-dependent pilin
Location 1800493 - 1800912 (strand: 1)
Length 420 (nucleotides) / 139 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_911
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF07963 Prokaryotic N-terminal methylation motif

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4969 Cell motility (N)
Extracellular structures (W)
NW Type IV pilus assembly protein, major pilin PilA

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02682 prepilin peptidase dependent protein D - -

Protein Sequence

MNQHGFTLIEVMVVVAIVAVLSAIAVPGYQNYIRKAALIDVLRTVTAFKTGIELCSFDSPLFAGCNSGQGTIPEDSPGRYLRTIKAENGVISAEGNSSLASLTLTATPAGNNANGVTRWTTACESPQESLKKLCLDVIK

Flanking regions ( +/- flanking 50bp)

GCTAATTAAGTAACCCGTTCACATACACATTCACACACAAAGGAGCCAGTATGAATCAACACGGATTTACCCTGATTGAAGTGATGGTCGTTGTTGCCATTGTCGCTGTTCTCAGTGCGATAGCCGTTCCCGGCTATCAAAACTATATTCGCAAAGCCGCACTTATCGATGTTTTGCGTACCGTCACTGCATTTAAAACCGGCATTGAGCTGTGCAGTTTTGACAGCCCGTTATTTGCCGGATGCAACAGTGGTCAGGGAACGATTCCTGAAGATTCACCCGGGCGTTACCTCCGGACAATTAAAGCTGAAAACGGGGTTATCTCAGCGGAGGGAAACAGTTCACTCGCCTCCCTCACACTTACCGCAACACCGGCCGGAAACAACGCGAACGGAGTCACCCGCTGGACAACAGCCTGTGAATCCCCTCAGGAAAGCCTGAAAAAACTTTGTCTCGATGTCATAAAATAACATACTGATATGAAAAGGAATTCATTATGCAACCGGGTACTGTATCTCCC