Homologs in group_154

Help

9 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09015 FBDBKF_09015 29.5 Morganella morganii S1 fimA Pilin (type 1 fimbrial protein)
EHELCC_10395 EHELCC_10395 29.5 Morganella morganii S2 fimA Pilin (type 1 fimbrial protein)
NLDBIP_10740 NLDBIP_10740 29.5 Morganella morganii S4 fimA Pilin (type 1 fimbrial protein)
LHKJJB_10615 LHKJJB_10615 29.5 Morganella morganii S3 fimA Pilin (type 1 fimbrial protein)
HKOGLL_13675 HKOGLL_13675 29.5 Morganella morganii S5 fimA Pilin (type 1 fimbrial protein)
F4V73_RS10955 F4V73_RS10955 31.2 Morganella psychrotolerans - fimbrial protein
PMI_RS01255 PMI_RS01255 27.4 Proteus mirabilis HI4320 - fimbrial protein
PMI_RS01305 PMI_RS01305 31.8 Proteus mirabilis HI4320 - fimbrial protein
PMI_RS10930 PMI_RS10930 26.1 Proteus mirabilis HI4320 - fimbrial protein

Distribution of the homologs in the orthogroup group_154

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_154

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P53521 1.01e-133 374 100 0 182 3 pmfF Putative minor fimbrial subunit PmfF Proteus mirabilis (strain HI4320)
P39264 9.73e-19 82 31 4 161 1 fimI Fimbrin-like protein FimI Escherichia coli (strain K12)
Q03011 2.1e-18 81 32 3 155 1 mrpA Major MR/P fimbria protein Proteus mirabilis (strain HI4320)
P13421 1.84e-16 76 33 2 154 1 smfA Fimbria A protein Serratia marcescens
P62532 4.6e-15 72 28 5 164 1 papK Fimbrial adapter PapK Escherichia coli
P62533 4.6e-15 72 28 5 164 3 papK Fimbrial adapter PapK Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P42191 3.72e-13 67 28 6 161 1 prsK Protein PrsK Escherichia coli
Q04681 1.5e-12 65 26 2 154 1 pmfA Major fimbrial subunit Proteus mirabilis (strain HI4320)
P37909 5.87e-10 58 28 5 185 1 ybgD Uncharacterized fimbrial-like protein YbgD Escherichia coli (strain K12)
P62605 7.3e-10 58 26 4 186 3 pilC Type-1 fimbrial protein, C chain Escherichia coli
P62606 7.3e-10 58 26 4 186 3 pilC Type-1 fimbrial protein, C chain Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P12730 5.63e-09 56 26 4 189 1 sfaA S-fimbrial protein subunit SfaA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P37926 3.41e-08 53 28 6 175 3 fimF Fimbrial-like protein FimF Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P37921 3.54e-08 54 24 6 193 1 fimA Type-1 fimbrial protein, A chain Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q47223 1.73e-07 52 29 4 154 1 fimA Type-1 fimbrial protein, A chain Escherichia coli
P37920 2.27e-07 52 24 6 193 3 fimA Type-1 fimbrial protein, A chain Salmonella typhi
P55223 3.82e-07 51 25 5 164 3 None Fimbrial subunit type 1 Salmonella typhimurium
Q8X5K5 8.39e-07 50 25 6 177 2 lpfA Probable major fimbrial subunit LpfA Escherichia coli O157:H7
P76499 1.85e-06 49 26 5 186 2 yfcP Uncharacterized fimbrial-like protein YfcP Escherichia coli (strain K12)
P37922 4.89e-06 48 24 5 177 3 fimI Fimbrin-like protein FimI Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P75855 5.52e-06 48 32 3 104 1 elfA Fimbrial subunit ElfA Escherichia coli (strain K12)
P08189 7.12e-06 47 27 5 154 1 fimF Protein FimF Escherichia coli (strain K12)
Q8X582 9.72e-06 47 32 4 108 1 elfA Laminin-binding fimbrial subunit ElfA Escherichia coli O157:H7
Q08456 1.94e-05 46 23 5 177 5 fimI Putative fimbrin-like protein FimI Salmonella typhi
P12903 4.9e-05 45 26 4 139 1 fim Fimbrial subunit type 1 Klebsiella pneumoniae
P42184 0.000229 43 26 5 163 1 prsA PRS fimbrial major pilin protein (Fragment) Escherichia coli
P04740 0.000563 42 24 5 195 3 KS71A KS71A fimbrillin Escherichia coli
P42913 0.000647 42 25 8 199 2 yraH Uncharacterized fimbrial-like protein YraH Escherichia coli (strain K12)
P04128 0.000731 42 25 3 120 1 fimA Type-1 fimbrial protein, A chain Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS09285
Feature type CDS
Gene -
Product fimbrial protein
Location 2029938 - 2030486 (strand: 1)
Length 549 (nucleotides) / 182 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_154
Orthogroup size 10
N. genomes 7

Actions

Genomic region

Domains

PF00419 Fimbrial protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3539 Cell motility (N) N Pilin (type 1 fimbrial protein)

Virulence factor Annotation(s)

VF gene ID Protein VF ID Category
VFG042614 type 1 fimbrial protein VF1236 Adherence

Protein Sequence

MKNSIIKSAITCLLLLSPSTFAATDIIGGEMEFKGVVVAHGCTIVAGDENKVIDFKQISAKDLYSLQKSNPVAFSISLENCSQDIYKSVTITLDGQAHSTMPNHIAVTGSGSEDPKSIGIAFTDKAHNIIELKKPSAPQQLNNKRVQFNFMAYVEATSSAIQNQTILTGPFQAQATYTLNYQ

Flanking regions ( +/- flanking 50bp)

ACTGAAGGTGAATTTTCAGCTCATGCGACACTCATTGCGGAGTTTATGTAATGAAAAACAGCATAATAAAGTCAGCTATAACTTGCTTGTTATTGCTCTCTCCTAGCACTTTTGCTGCCACTGATATTATTGGTGGAGAGATGGAATTTAAAGGTGTTGTTGTTGCACATGGTTGTACGATTGTTGCGGGAGATGAAAATAAAGTTATTGATTTCAAACAAATATCTGCAAAAGATCTCTATTCACTACAAAAAAGCAACCCCGTTGCTTTTAGTATCAGTTTAGAAAATTGTAGCCAAGATATTTATAAAAGTGTCACTATCACATTAGATGGTCAAGCACATTCAACAATGCCCAATCATATAGCCGTTACTGGGAGTGGCTCAGAAGATCCGAAAAGTATTGGTATCGCTTTTACCGACAAGGCACATAATATTATTGAATTAAAAAAACCAAGTGCCCCTCAACAGCTTAATAATAAACGAGTACAATTTAATTTTATGGCCTATGTTGAAGCAACATCATCAGCTATTCAAAATCAAACGATACTCACAGGACCATTTCAAGCACAAGCAACCTATACACTCAATTACCAATAACAATTAAGCCAAATAGATGCTATTTGGCTTTCTCTTGTATGATTAAACCT