Homologs in group_175

Help

8 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09015 FBDBKF_09015 100.0 Morganella morganii S1 fimA Pilin (type 1 fimbrial protein)
EHELCC_10395 EHELCC_10395 100.0 Morganella morganii S2 fimA Pilin (type 1 fimbrial protein)
LHKJJB_10615 LHKJJB_10615 100.0 Morganella morganii S3 fimA Pilin (type 1 fimbrial protein)
HKOGLL_13675 HKOGLL_13675 100.0 Morganella morganii S5 fimA Pilin (type 1 fimbrial protein)
F4V73_RS10955 F4V73_RS10955 83.3 Morganella psychrotolerans - fimbrial protein
PMI_RS01255 PMI_RS01255 48.8 Proteus mirabilis HI4320 - fimbrial protein
PMI_RS01305 PMI_RS01305 64.6 Proteus mirabilis HI4320 - fimbrial protein
PMI_RS09285 PMI_RS09285 29.5 Proteus mirabilis HI4320 - fimbrial protein

Distribution of the homologs in the orthogroup group_175

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_175

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P53521 1.35e-18 82 30 2 173 3 pmfF Putative minor fimbrial subunit PmfF Proteus mirabilis (strain HI4320)
Q03011 3.55e-18 80 35 3 150 1 mrpA Major MR/P fimbria protein Proteus mirabilis (strain HI4320)
P62532 2.43e-14 70 30 5 164 1 papK Fimbrial adapter PapK Escherichia coli
P62533 2.43e-14 70 30 5 164 3 papK Fimbrial adapter PapK Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P13421 5.61e-13 67 32 5 154 1 smfA Fimbria A protein Serratia marcescens
P42191 9.37e-13 66 30 6 164 1 prsK Protein PrsK Escherichia coli
P76499 4.81e-12 64 27 3 156 2 yfcP Uncharacterized fimbrial-like protein YfcP Escherichia coli (strain K12)
Q8X5K5 6.65e-12 63 29 6 152 2 lpfA Probable major fimbrial subunit LpfA Escherichia coli O157:H7
Q04681 7.07e-12 63 24 1 161 1 pmfA Major fimbrial subunit Proteus mirabilis (strain HI4320)
P43660 2.91e-08 54 25 7 181 3 lpfA Long polar fimbria protein A Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P12903 1.09e-07 52 32 5 128 1 fim Fimbrial subunit type 1 Klebsiella pneumoniae
P04740 2.68e-07 51 26 7 200 3 KS71A KS71A fimbrillin Escherichia coli
P37926 3.98e-07 50 27 7 180 3 fimF Fimbrial-like protein FimF Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P38052 4.21e-07 50 28 7 186 2 sfmF Uncharacterized fimbrial-like protein SfmF Escherichia coli (strain K12)
P04127 4.9e-06 48 25 3 155 1 papA Pap fimbrial major pilin protein Escherichia coli
Q8X582 6.24e-06 47 26 7 186 1 elfA Laminin-binding fimbrial subunit ElfA Escherichia coli O157:H7
P04128 7.86e-06 47 29 6 131 1 fimA Type-1 fimbrial protein, A chain Escherichia coli (strain K12)
P75855 9.47e-06 47 26 7 186 1 elfA Fimbrial subunit ElfA Escherichia coli (strain K12)
P39264 1.14e-05 47 27 5 166 1 fimI Fimbrin-like protein FimI Escherichia coli (strain K12)
P12266 1.24e-05 47 28 6 128 1 None Fimbrial subunit type 1 Klebsiella pneumoniae
P77288 1.32e-05 47 27 5 166 2 yfcV Uncharacterized fimbrial-like protein YfcV Escherichia coli (strain K12)
P42184 1.35e-05 46 26 5 160 1 prsA PRS fimbrial major pilin protein (Fragment) Escherichia coli
Q47223 5.87e-05 45 27 7 161 1 fimA Type-1 fimbrial protein, A chain Escherichia coli
P39834 6.73e-05 45 33 0 56 3 ygiL Uncharacterized fimbrial-like protein YgiL Escherichia coli (strain K12)
P12730 0.000118 44 26 6 159 1 sfaA S-fimbrial protein subunit SfaA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P37909 0.000192 43 23 6 179 1 ybgD Uncharacterized fimbrial-like protein YbgD Escherichia coli (strain K12)
P42185 0.000226 43 25 5 157 3 prsH PRS fimbrial minor pilin protein Escherichia coli
P62605 0.00027 43 28 9 160 3 pilC Type-1 fimbrial protein, C chain Escherichia coli
P62606 0.00027 43 28 9 160 3 pilC Type-1 fimbrial protein, C chain Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P07111 0.000802 42 24 5 157 1 papH PAP fimbrial minor pilin protein Escherichia coli

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_10740
Feature type CDS
Gene fimA
Product Pilin (type 1 fimbrial protein)
Location 105581 - 106126 (strand: 1)
Length 546 (nucleotides) / 181 (amino acids)
In genomic island -

Contig

Accession ZDB_525
Length 191527 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_175
Orthogroup size 9
N. genomes 7

Actions

Genomic region

Domains

PF00419 Fimbrial protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3539 Cell motility (N) N Pilin (type 1 fimbrial protein)

Virulence factor Annotation(s)

VF gene ID Protein VF ID Category
VFG042627 type 1 fimbrial protein VF1233 Adherence

Protein Sequence

MNETIRRFFISTCGVFLLSLPGADAGAVPDNLYFHGTLVDEPCTIHPGDETVELPFGNIPDKNLYAYQRTPSKDFRIRLSECDTSIGRRVTVMFAGDENPFISGALAISLGSQAEGIAVGLENADGTALAVNEVSPQITLNDGLTLLNFRAYVQGEPDALANKTIKRGPFSAIATFHLNYD

Flanking regions ( +/- flanking 50bp)

ATTTGATGTGACCGCTACACTGCTGGCGGAATATCAGTAGGAGCAATGCAATGAATGAAACAATAAGGCGCTTTTTTATCAGTACCTGCGGTGTATTTCTGTTATCACTGCCGGGGGCGGATGCCGGGGCGGTTCCTGACAACCTGTATTTTCACGGTACGCTGGTGGATGAACCCTGCACGATACATCCGGGGGATGAAACCGTGGAACTGCCGTTCGGCAATATTCCTGATAAAAACCTGTACGCCTATCAGCGGACACCCTCAAAGGATTTCCGGATCCGGCTCTCGGAGTGTGACACCTCTATCGGCAGGCGGGTGACAGTGATGTTTGCCGGGGATGAGAATCCGTTTATCAGCGGTGCGCTGGCGATAAGTCTGGGCAGTCAGGCGGAAGGCATTGCAGTCGGGCTGGAAAATGCGGACGGCACGGCGCTGGCGGTCAATGAGGTGTCACCGCAGATCACGCTGAATGACGGACTGACGCTGCTGAACTTCCGCGCCTATGTGCAGGGAGAGCCGGATGCGCTGGCAAATAAAACCATTAAACGCGGGCCGTTCAGTGCCATTGCGACATTTCATCTCAATTATGACTGACGGGTAACTGAGGCTCGCTATGAACAGATTTATGAAAATAATTGCGGCGC