Homologs in group_480

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00765 FBDBKF_00765 78.3 Morganella morganii S1 cheY chemotaxis response regulator CheY
EHELCC_00780 EHELCC_00780 78.3 Morganella morganii S2 cheY chemotaxis response regulator CheY
NLDBIP_02680 NLDBIP_02680 78.3 Morganella morganii S4 cheY chemotaxis response regulator CheY
LHKJJB_04195 LHKJJB_04195 78.3 Morganella morganii S3 cheY chemotaxis response regulator CheY
HKOGLL_02850 HKOGLL_02850 78.3 Morganella morganii S5 cheY chemotaxis response regulator CheY
F4V73_RS06765 F4V73_RS06765 78.3 Morganella psychrotolerans cheY chemotaxis response regulator CheY

Distribution of the homologs in the orthogroup group_480

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_480

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8D0P1 1.6e-76 225 84 0 129 3 cheY Chemotaxis protein CheY Yersinia pestis
Q9FAD7 1.19e-75 223 83 0 129 3 cheY Chemotaxis protein CheY Enterobacter cloacae
Q93P00 1.24e-75 223 83 0 129 3 cheY Chemotaxis protein CheY Yersinia enterocolitica
P0AE69 3.05e-75 222 83 0 129 3 cheY Chemotaxis protein CheY Shigella flexneri
P0AE67 3.05e-75 222 83 0 129 1 cheY Chemotaxis protein CheY Escherichia coli (strain K12)
P0AE68 3.05e-75 222 83 0 129 3 cheY Chemotaxis protein CheY Escherichia coli O157:H7
Q8FGP6 5.83e-75 221 83 0 129 3 cheY Chemotaxis protein CheY Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A2D5 1.81e-74 220 82 0 129 1 cheY Chemotaxis protein CheY Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2D6 1.81e-74 220 82 0 129 3 cheY Chemotaxis protein CheY Salmonella typhi
Q9KQD5 2.43e-57 177 64 0 125 1 VC_2065 Chemotaxis protein CheY-3 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A0A0H3AMJ9 2.43e-57 177 64 0 125 1 cheY-3 Chemotaxis protein CheY-3 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q51455 2.49e-53 166 60 0 122 3 cheY Chemotaxis protein CheY Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P71403 2.07e-36 124 47 1 120 1 cheY1 Chemotaxis protein CheY1 Helicobacter pylori (strain ATCC 700392 / 26695)
Q9ZM64 2.21e-35 121 48 1 116 3 cheY1 Chemotaxis protein CheY1 Helicobacter pylori (strain J99 / ATCC 700824)
A1W0A5 5.74e-33 115 45 1 120 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
P0C635 5.74e-33 115 45 1 120 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A8FMH1 5.74e-33 115 45 1 120 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
P24072 2.91e-20 82 38 1 116 1 cheY Chemotaxis protein CheY Bacillus subtilis (strain 168)
Q2KCH7 1.11e-17 76 29 0 125 3 cheY Probable chemotaxis protein CheY Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
P18769 1.63e-17 80 38 1 108 1 frzE Gliding motility regulatory protein Myxococcus xanthus
P0A4H5 3.92e-17 74 37 1 117 3 cheY Chemotaxis protein CheY Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
P0A4H6 3.92e-17 74 37 1 117 3 cheY Chemotaxis protein CheY Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P58662 7.26e-17 79 40 3 126 3 rcsC Sensor histidine kinase RcsC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P35163 1.45e-16 75 33 2 110 1 resD Transcriptional regulatory protein ResD Bacillus subtilis (strain 168)
P0AFJ5 1.54e-16 75 29 1 121 1 phoB Phosphate regulon transcriptional regulatory protein PhoB Escherichia coli (strain K12)
P0AFJ6 1.54e-16 75 29 1 121 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Escherichia coli O157:H7
P45606 1.57e-16 75 29 1 121 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Shigella dysenteriae
P45607 1.67e-16 75 29 1 121 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Shigella flexneri
P45605 2.34e-16 75 31 1 121 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Klebsiella pneumoniae
Q56128 2.82e-16 77 40 3 126 3 rcsC Sensor histidine kinase RcsC Salmonella typhi
P0DMC5 8.27e-16 75 39 3 123 1 rcsC Sensor histidine kinase RcsC Escherichia coli (strain K12)
P0DMC6 3.47e-15 73 39 3 123 1 rcsC Sensor histidine kinase RcsC Escherichia coli
P45189 9.77e-15 70 26 2 121 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9I4F9 1.28e-14 70 30 2 121 1 phoP Two-component response regulator PhoP Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O78428 2.12e-14 70 33 2 120 3 ycf27 Probable transcriptional regulator ycf27 Guillardia theta
P0C0F6 3.24e-14 71 36 3 121 1 rpfC Sensory/regulatory protein RpfC Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
P23620 3.8e-14 69 28 1 121 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0C0F7 4.73e-14 70 36 3 121 1 rpfC Sensory/regulatory protein RpfC Xanthomonas campestris pv. campestris (strain 8004)
P28835 6.65e-14 68 29 2 121 3 ycf27 Probable transcriptional regulator ycf27 Porphyridium aerugineum
P30855 7.55e-14 70 35 2 122 1 evgS Sensor protein EvgS Escherichia coli (strain K12)
Q54SP4 1.07e-13 69 37 1 105 2 dhkD Hybrid signal transduction histidine kinase D Dictyostelium discoideum
Q56312 1.11e-13 65 30 1 117 1 cheY Chemotaxis protein CheY Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q9TLQ4 1.2e-13 68 30 2 121 3 ycf27 Probable transcriptional regulator ycf27 Cyanidium caldarium
P45337 1.85e-13 67 33 2 121 3 qseB Transcriptional regulatory protein QseB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q47744 2.05e-13 67 34 2 123 3 vanRB Regulatory protein VanRB Enterococcus faecalis (strain ATCC 700802 / V583)
P46384 2.06e-13 65 32 3 113 1 pilG Protein PilG Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A1TEL7 2.12e-13 67 38 3 118 3 mprA Response regulator MprA Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
P48259 2.65e-13 67 32 2 120 3 ycf27 Probable transcriptional regulator ycf27 Cyanophora paradoxa
P58402 2.99e-13 68 34 2 122 3 evgS Sensor protein EvgS Escherichia coli O157:H7
Q742C1 3.32e-13 66 37 3 118 3 mprA Response regulator MprA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QBQ9 3.32e-13 66 37 3 118 3 mprA Response regulator MprA Mycobacterium avium (strain 104)
A0R3I8 3.7e-13 66 37 3 118 1 mprA Response regulator MprA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
A0PWB4 4.16e-13 66 37 3 118 3 mprA Response regulator MprA Mycobacterium ulcerans (strain Agy99)
A1KHB7 4.84e-13 66 37 3 118 3 mprA Response regulator MprA Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q7U0X4 4.84e-13 66 37 3 118 1 mprA Response regulator MprA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q1B3X8 5.1e-13 66 37 3 118 3 mprA Response regulator MprA Mycobacterium sp. (strain MCS)
A1UL70 5.1e-13 66 37 3 118 3 mprA Response regulator MprA Mycobacterium sp. (strain KMS)
A3Q5L9 5.1e-13 66 37 3 118 3 mprA Response regulator MprA Mycobacterium sp. (strain JLS)
P25852 5.4e-13 67 37 2 115 1 zraR Transcriptional regulatory protein ZraR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z333 5.45e-13 67 37 2 115 3 zraR Transcriptional regulatory protein ZraR Salmonella typhi
Q10WZ6 5.54e-13 67 36 3 125 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Trichodesmium erythraeum (strain IMS101)
P72781 7.34e-13 65 32 0 115 1 rre1 Response regulator Rre1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q1XDC9 1.07e-12 65 30 2 126 3 ycf27 Probable transcriptional regulator ycf27 Neopyropia yezoensis
P28257 1.11e-12 65 31 2 121 3 ycf27 Probable transcriptional regulator ycf27 Galdieria sulphuraria
O25154 1.13e-12 66 33 3 128 3 cheV3 Chemotaxis protein CheV3 Helicobacter pylori (strain ATCC 700392 / 26695)
P51358 1.21e-12 65 30 2 126 3 ycf27 Probable transcriptional regulator ycf27 Porphyra purpurea
B0R4K1 1.23e-12 63 35 3 106 1 cheY Chemotaxis protein CheY Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q99U73 1.42e-12 65 32 3 117 3 arlR Response regulator ArlR Staphylococcus aureus (strain N315)
P0A4I0 1.62e-12 65 35 3 108 3 dltR Transcriptional regulatory protein DltR Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P0A4H9 1.62e-12 65 35 3 108 3 dltR Transcriptional regulatory protein DltR Streptococcus agalactiae serotype III (strain NEM316)
Q5JF95 1.7e-12 65 37 3 114 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
P0C001 1.77e-12 64 32 3 117 3 arlR Response regulator ArlR Staphylococcus aureus (strain MW2)
Q6G9E6 1.77e-12 64 32 3 117 3 arlR Response regulator ArlR Staphylococcus aureus (strain MSSA476)
Q6GGZ3 1.77e-12 64 32 3 117 3 arlR Response regulator ArlR Staphylococcus aureus (strain MRSA252)
P0C000 1.77e-12 64 32 3 117 3 arlR Response regulator ArlR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HG04 1.77e-12 64 32 3 117 3 arlR Response regulator ArlR Staphylococcus aureus (strain COL)
Q2YY03 1.77e-12 64 32 3 117 3 arlR Response regulator ArlR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q9KJN4 1.77e-12 64 32 3 117 1 arlR Response regulator ArlR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH23 1.77e-12 64 32 3 117 3 arlR Response regulator ArlR Staphylococcus aureus (strain USA300)
Q49XM7 1.82e-12 64 31 3 117 3 arlR Response regulator ArlR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q52990 2.09e-12 64 29 1 117 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Rhizobium meliloti (strain 1021)
P9WGM9 2.19e-12 64 36 3 118 1 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM8 2.19e-12 64 36 3 118 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U123 2.19e-12 64 36 3 118 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
P0AFB8 2.65e-12 65 38 2 102 1 glnG DNA-binding transcriptional regulator NtrC Escherichia coli (strain K12)
P0AFB9 2.65e-12 65 38 2 102 3 glnG DNA-binding transcriptional regulator NtrC Escherichia coli O157:H7
O69730 2.82e-12 64 37 2 104 1 tcrX Probable transcriptional regulatory protein TcrX Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P41789 2.83e-12 65 38 2 102 1 glnG DNA-binding transcriptional regulator NtrC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A0QTK2 3.2e-12 64 32 2 105 1 mtrA DNA-binding response regulator MtrA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q55933 3.43e-12 64 32 3 120 1 rppA Response regulator RppA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q9ZEP4 4.72e-12 63 29 2 120 1 cseB Transcriptional regulatory protein CseB Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q9CD68 4.88e-12 63 36 3 118 3 mprA Response regulator MprA Mycobacterium leprae (strain TN)
Q93CB8 5.01e-12 63 31 2 105 3 mtrA DNA-binding response regulator MtrA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q9CCJ2 5.01e-12 63 31 2 105 3 mtrA DNA-binding response regulator MtrA Mycobacterium leprae (strain TN)
P9WGM7 5.14e-12 63 31 2 105 1 mtrA DNA-binding response regulator MtrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM6 5.14e-12 63 31 2 105 3 mtrA DNA-binding response regulator MtrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Z5 5.14e-12 63 31 2 105 3 mtrA DNA-binding response regulator MtrA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q9APD9 5.19e-12 64 35 2 111 3 zraR Transcriptional regulatory protein ZraR Klebsiella oxytoca
T2KMF4 5.3e-12 64 32 1 117 3 BN863_21930 Histidine kinase P4 Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1)
Q06065 5.78e-12 64 37 2 105 1 atoC Regulatory protein AtoC Escherichia coli (strain K12)
Q5L0L0 6.2e-12 64 39 3 110 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Geobacillus kaustophilus (strain HTA426)
P28787 6.72e-12 64 34 3 121 3 ntrC DNA-binding transcriptional regulator NtrC Proteus hauseri
A7N6S2 6.82e-12 64 31 3 121 1 cqsS CAI-1 autoinducer sensor kinase/phosphatase CqsS Vibrio campbellii (strain ATCC BAA-1116)
Q7A0U4 7.07e-12 63 30 2 104 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MW2)
Q9L524 7.07e-12 63 30 2 104 2 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus
Q6G972 7.07e-12 63 30 2 104 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MSSA476)
Q6GGK6 7.07e-12 63 30 2 104 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MRSA252)
Q7A5H6 7.07e-12 63 30 2 104 1 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain N315)
Q7A2R6 7.07e-12 63 30 2 104 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HFT0 7.07e-12 63 30 2 104 2 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain COL)
Q2FY79 7.07e-12 63 30 2 104 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q75KW7 7.61e-12 61 34 5 131 3 RR41 Two-component response regulator ORR41 Oryza sativa subsp. japonica
Q82EB1 8.06e-12 63 29 2 120 3 cseB Transcriptional regulatory protein CseB Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
L7N689 9.71e-12 63 32 3 121 1 trcR Transcriptional regulatory protein TrcR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P51586 9.74e-12 61 35 1 103 3 None Uncharacterized 14.6 kDa protein in sodA1 3'region Leptolyngbya boryana
Q9KM66 9.87e-12 63 33 3 118 1 cqsS CAI-1 autoinducer sensor kinase/phosphatase CqsS Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9FXD6 1.07e-11 63 37 4 108 1 ARR11 Two-component response regulator ARR11 Arabidopsis thaliana
P14375 1.22e-11 63 34 2 122 1 zraR Transcriptional regulatory protein ZraR Escherichia coli (strain K12)
Q8X613 1.71e-11 63 34 2 122 3 zraR Transcriptional regulatory protein ZraR Escherichia coli O157:H7
O25153 1.74e-11 63 31 2 117 1 cheAY Sensor histidine kinase CheAY Helicobacter pylori (strain ATCC 700392 / 26695)
Q4GZL0 2.07e-11 62 32 2 116 2 RR1 Two-component response regulator ORR1 Oryza sativa subsp. indica
Q44006 2.08e-11 62 33 2 121 2 czcR Transcriptional activator protein CzcR Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q02540 2.08e-11 62 31 3 121 1 copR Transcriptional activator protein CopR Pseudomonas syringae pv. tomato
P23836 2.11e-11 62 33 2 106 1 phoP Transcriptional regulatory protein PhoP Escherichia coli (strain K12)
Q9KA55 2.34e-11 62 35 3 108 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q2HWG4 2.36e-11 62 32 2 116 2 RR1 Two-component response regulator ORR1 Oryza sativa subsp. japonica
Q83RR0 2.42e-11 61 33 2 106 3 phoP Virulence transcriptional regulatory protein PhoP Shigella flexneri
Q8CXZ9 2.42e-11 61 33 2 106 3 phoP Transcriptional regulatory protein PhoP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P43501 2.46e-11 59 27 1 118 3 pilH Protein PilH Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0DM78 2.47e-11 61 35 2 106 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
F5ZP95 2.47e-11 61 35 2 106 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain ATCC 68169 / UK-1)
E1WFA1 2.47e-11 61 35 2 106 2 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain SL1344)
D0ZV90 2.47e-11 61 35 2 106 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain 14028s / SGSC 2262)
Q5PMJ1 2.47e-11 61 35 2 106 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q1IQS9 2.48e-11 62 32 4 134 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Koribacter versatilis (strain Ellin345)
Q8Z7H2 2.55e-11 61 35 2 106 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhi
P21866 3.04e-11 61 31 2 113 1 kdpE KDP operon transcriptional regulatory protein KdpE Escherichia coli (strain K12)
Q9I4N3 3.42e-11 62 38 4 118 1 fleR Response regulator protein FleR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q31S42 3.79e-11 61 32 2 117 1 rpaA DNA-binding dual master transcriptional regulator RpaA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P48359 5.17e-11 60 29 2 121 3 ycf29 Probable transcriptional regulator ycf29 Cyanophora paradoxa
P31079 5.25e-11 60 29 3 127 3 petR Protein PetR Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
G3XCY6 6.04e-11 60 28 1 126 1 gltR Transcriptional regulatory protein GltR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P13792 6.76e-11 60 30 2 107 1 phoP Alkaline phosphatase synthesis transcriptional regulatory protein PhoP Bacillus subtilis (strain 168)
P03029 8.83e-11 61 35 2 102 1 ntrC DNA-binding transcriptional regulator NtrC Klebsiella pneumoniae
Q940D0 9.07e-11 61 32 4 131 1 ARR1 Two-component response regulator ARR1 Arabidopsis thaliana
O25918 1.05e-10 60 32 3 117 3 crdR Transcriptional regulatory protein CrdR Helicobacter pylori (strain ATCC 700392 / 26695)
Q8X738 1.05e-10 60 33 2 106 3 phoP Transcriptional regulatory protein PhoP Escherichia coli O157:H7
Q6K9T0 1.06e-10 58 28 2 119 2 RR3 Two-component response regulator ORR3 Oryza sativa subsp. japonica
Q4GZK8 1.06e-10 58 28 2 119 2 RR3 Two-component response regulator ORR3 Oryza sativa subsp. indica
Q5A872 1.16e-10 61 30 2 120 1 SLN1 Histidine protein kinase SLN1 Candida albicans (strain SC5314 / ATCC MYA-2876)
Q9AE24 1.21e-10 60 28 2 122 3 rprY Transcriptional regulatory protein RprY Bacteroides fragilis (strain YCH46)
P39928 1.22e-10 60 33 2 110 1 SLN1 Osmosensing histidine protein kinase SLN1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q57QC3 1.33e-10 59 34 2 106 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella choleraesuis (strain SC-B67)
Q8DPL7 1.34e-10 59 30 4 121 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2UQ68 1.34e-10 59 30 4 121 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
A0A0H2ZN37 1.34e-10 59 30 4 121 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q5N6V8 1.65e-10 60 32 4 124 3 RR26 Two-component response regulator ORR26 Oryza sativa subsp. japonica
Q54RP6 1.67e-10 60 31 3 122 3 dhkL Hybrid signal transduction histidine kinase L Dictyostelium discoideum
Q7D9K0 1.69e-10 59 32 3 122 3 tcrA Transcriptional regulatory protein TcrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O07776 1.69e-10 59 32 3 122 1 tcrA Transcriptional regulatory protein TcrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P0CL17 1.98e-10 59 31 2 121 2 tctD Transcriptional regulatory protein TctD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
E1WA34 1.98e-10 59 31 2 121 3 tctD Transcriptional regulatory protein TctD Salmonella typhimurium (strain SL1344)
Q55890 2.29e-10 59 31 2 117 1 rpaA DNA-binding dual master transcriptional regulator RpaA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q9F868 2.54e-10 58 29 2 118 1 regX3 Sensory transduction protein RegX3 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P0DMK7 2.75e-10 58 30 2 121 3 irlR Transcriptional activator protein IrlR Burkholderia pseudomallei (strain K96243)
I1WSZ4 2.75e-10 58 30 2 121 3 irlR Transcriptional activator protein IrlR Burkholderia pseudomallei (strain 1026b)
Q7MD16 2.93e-10 59 32 2 115 3 luxQ Autoinducer 2 sensor kinase/phosphatase LuxQ Vibrio vulnificus (strain YJ016)
Q9FPR6 3.02e-10 57 30 3 127 2 ARR17 Two-component response regulator ARR17 Arabidopsis thaliana
Q8D5Z6 3.2e-10 59 32 2 115 3 luxQ Autoinducer 2 sensor kinase/phosphatase LuxQ Vibrio vulnificus (strain CMCP6)
Q9SHC2 3.4e-10 57 31 3 129 1 ARR16 Two-component response regulator ARR16 Arabidopsis thaliana
Q04942 3.52e-10 58 26 2 119 1 afsQ1 Transcriptional regulatory protein AfsQ1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q6H468 3.84e-10 57 29 2 117 2 RR11 Two-component response regulator ORR11 Oryza sativa subsp. japonica
B8AFR8 3.84e-10 57 29 2 117 3 RR11 Two-component response regulator ORR11 Oryza sativa subsp. indica
Q2FWH6 4.01e-10 58 28 2 101 1 kdpE Transcriptional regulatory protein KdpE Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q1XDE4 4.54e-10 58 29 1 105 3 ycf29 Probable transcriptional regulator ycf29 Neopyropia yezoensis
Q9KS59 4.55e-10 58 33 2 107 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
O49397 5.93e-10 58 34 4 108 1 ARR10 Two-component response regulator ARR10 Arabidopsis thaliana
Q9I0I1 6.77e-10 57 32 3 121 1 carR Response regulator protein CarR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P48027 6.84e-10 58 32 2 115 3 gacS Sensor protein GacS Pseudomonas syringae pv. syringae
P54302 6.87e-10 58 32 2 115 1 luxQ Autoinducer 2 sensor kinase/phosphatase LuxQ Vibrio harveyi
P45709 7.07e-10 55 31 1 118 3 ccdB Protein CcdB Bacillus subtilis (strain 168)
Q9ZWJ9 8.36e-10 58 34 4 109 1 ARR2 Two-component response regulator ARR2 Arabidopsis thaliana
Q86AT9 8.98e-10 58 31 4 123 3 dhkI-1 Hybrid signal transduction histidine kinase I Dictyostelium discoideum
Q2HWH1 9.8e-10 55 29 2 117 2 RR5 Two-component response regulator ORR5 Oryza sativa subsp. japonica
Q4GZK6 9.8e-10 55 29 2 117 2 RR5 Two-component response regulator ORR5 Oryza sativa subsp. indica
P37478 9.86e-10 57 30 2 109 1 walR Transcriptional regulatory protein WalR Bacillus subtilis (strain 168)
Q8KIY1 1e-09 58 29 1 122 1 tmoS Sensor histidine kinase TmoS Pseudomonas mendocina
A1A698 1.01e-09 58 32 3 137 2 HK4 Probable histidine kinase 4 Oryza sativa subsp. japonica
Q7G8V2 1.01e-09 57 28 2 121 1 ARR15 Two-component response regulator ARR15 Arabidopsis thaliana
P31802 1.03e-09 57 33 2 115 3 narP Nitrate/nitrite response regulator protein NarP Escherichia coli (strain K12)
P9WGL9 1.04e-09 57 29 2 120 1 regX3 Sensory transduction protein RegX3 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGL8 1.04e-09 57 29 2 120 2 regX3 Sensory transduction protein RegX3 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O07130 1.04e-09 57 29 2 120 1 regX3 Sensory transduction protein RegX3 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q6H805 1.06e-09 58 35 4 108 2 RR24 Two-component response regulator ORR24 Oryza sativa subsp. japonica
A2X1N2 1.07e-09 58 35 4 108 3 RR24 Two-component response regulator ORR24 Oryza sativa subsp. indica
Q2RRX2 1.17e-09 58 36 2 106 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
P50351 1.23e-09 57 33 1 93 3 chvI Transcriptional regulatory protein ChvI Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P9WGM3 1.24e-09 57 32 1 106 1 pdtaR Transcriptional regulatory protein PdtaR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM2 1.24e-09 57 32 1 106 3 pdtaR Transcriptional regulatory protein PdtaR Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P62598 1.52e-09 57 33 4 108 2 ARR12 Two-component response regulator ARR12 Arabidopsis thaliana
P33112 1.6e-09 56 28 3 121 3 spaR Transcriptional regulatory protein SpaR Bacillus subtilis
Q87GU5 1.74e-09 57 30 2 115 3 luxQ Autoinducer 2 sensor kinase/phosphatase LuxQ Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A2XYV5 1.76e-09 55 26 1 124 2 RR6 Two-component response regulator ORR6 Oryza sativa subsp. indica
P50350 1.85e-09 57 33 1 93 3 chvI Transcriptional regulatory protein ChvI Rhizobium meliloti (strain 1021)
Q7XQA6 1.85e-09 55 26 1 124 2 RR6 Two-component response regulator ORR6 Oryza sativa subsp. japonica
Q7NSI8 2.02e-09 57 32 4 132 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
B8GZM2 2.14e-09 57 31 1 110 1 pleD Response regulator PleD Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A5I5 2.14e-09 57 31 1 110 1 pleD Response regulator PleD Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P24908 2.16e-09 56 35 2 103 1 PA0034 Putative transcriptional regulator Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9ZHD3 2.22e-09 56 29 3 121 3 silR Probable transcriptional regulatory protein SilR Salmonella typhimurium
Q9UYF3 2.27e-09 57 31 3 116 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Pyrococcus abyssi (strain GE5 / Orsay)
P94413 2.36e-09 56 23 2 121 3 yclJ Uncharacterized transcriptional regulatory protein YclJ Bacillus subtilis (strain 168)
Q8RAZ3 2.87e-09 57 36 3 110 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q9C5U0 2.93e-09 57 35 4 128 1 AHK4 Histidine kinase 4 Arabidopsis thaliana
Q04803 2.96e-09 56 29 2 115 3 pfeR Transcriptional activator protein PfeR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q4UU85 3.39e-09 56 24 1 121 1 rpfG Cyclic di-GMP phosphodiesterase response regulator RpfG Xanthomonas campestris pv. campestris (strain 8004)
P9WGN1 3.55e-09 55 34 2 103 1 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGN0 3.55e-09 55 34 2 103 3 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A0A4P7TS68 3.91e-09 55 28 4 126 1 ompR DNA-binding dual transcriptional regulator OmpR Shigella flexneri serotype 5a (strain M90T)
P0AA21 3.91e-09 55 28 4 126 3 ompR DNA-binding dual transcriptional regulator OmpR Shigella flexneri
P0AA19 3.91e-09 55 28 4 126 3 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A0A0H3NGY1 3.91e-09 55 28 4 126 3 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhimurium (strain SL1344)
P0AA20 3.91e-09 55 28 4 126 1 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhi
P0AA16 3.91e-09 55 28 4 126 1 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli (strain K12)
P0AA17 3.91e-09 55 28 4 126 3 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AA18 3.91e-09 55 28 4 126 3 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli O157:H7
Q4L6C6 3.92e-09 55 28 2 104 3 arlR Response regulator ArlR Staphylococcus haemolyticus (strain JCSC1435)
A2XE31 4.57e-09 56 28 5 125 3 RR21 Two-component response regulator ORR21 Oryza sativa subsp. indica
Q9F8D7 4.69e-09 56 32 2 115 3 gacS Sensor histidine kinase GacS Pseudomonas protegens (strain DSM 19095 / LMG 27888 / CFBP 6595 / CHA0)
Q05522 4.79e-09 56 33 4 125 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Bacillus subtilis (strain 168)
Q8EQW0 4.86e-09 56 31 3 110 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8H7S7 4.89e-09 56 28 5 125 2 RR21 Two-component response regulator ORR21 Oryza sativa subsp. japonica
Q9HV32 5.41e-09 55 33 2 95 1 pmrA Response regulator protein PmrA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q2HWG1 5.74e-09 53 31 2 118 2 RR12 Two-component response regulator ORR12 Oryza sativa subsp. japonica
Q9LYP5 5.79e-09 56 32 5 122 2 ARR21 Putative two-component response regulator ARR21 Arabidopsis thaliana
Q07783 6.06e-09 55 29 2 117 3 chvI Transcriptional regulatory protein ChvI Rhizobium radiobacter
Q39T95 6.13e-09 55 31 3 119 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q8L9Y3 6.76e-09 55 28 4 125 1 ARR14 Two-component response regulator ARR14 Arabidopsis thaliana
P54884 7.27e-09 54 31 1 91 3 rgx3 Sensory transduction protein RegX3 Mycobacterium leprae (strain TN)
O74539 7.4e-09 55 30 3 120 1 mak3 Peroxide stress-activated histidine kinase mak3 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P42244 7.44e-09 55 29 2 104 3 ycbL Uncharacterized transcriptional regulatory protein YcbL Bacillus subtilis (strain 168)
Q9AAK0 8e-09 55 35 3 110 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q01473 8.51e-09 55 34 4 107 3 rcaC Protein RcaC Microchaete diplosiphon
Q01473 5.86e-07 50 29 2 121 3 rcaC Protein RcaC Microchaete diplosiphon
Q9M9B9 8.51e-09 55 33 5 121 2 ARR19 Putative two-component response regulator ARR19 Arabidopsis thaliana
Q4L8V4 8.93e-09 55 29 2 124 3 lytR Sensory transduction protein LytR Staphylococcus haemolyticus (strain JCSC1435)
P76340 9.06e-09 54 28 2 107 1 hprR Transcriptional regulatory protein HprR Escherichia coli (strain K12)
Q6AJV3 9.71e-09 55 35 4 110 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
P9WGM5 1e-08 54 34 3 110 1 narL Probable transcriptional regulatory protein NarL Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM4 1e-08 54 34 3 110 3 narL Probable transcriptional regulatory protein NarL Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A4H2 1.03e-08 54 32 2 103 1 bvgA Virulence factors putative positive transcription regulator BvgA Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P0A4H4 1.03e-08 54 32 2 103 3 bvgA Virulence factors putative positive transcription regulator BvgA Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
P0A4H3 1.03e-08 54 32 2 103 3 bvgA Virulence factors putative positive transcription regulator BvgA Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q8GVV6 1.04e-08 52 32 2 105 2 RR8 Two-component response regulator ORR8 Oryza sativa subsp. japonica
Q4GZK3 1.04e-08 52 32 2 105 2 RR8 Two-component response regulator ORR8 Oryza sativa subsp. indica
Q9ZWS7 1.06e-08 54 25 2 125 1 ARR7 Two-component response regulator ARR7 Arabidopsis thaliana
Q50136 1.34e-08 54 31 2 104 3 prrA Transcriptional regulatory protein PrrA Mycobacterium leprae (strain TN)
P44845 1.35e-08 54 28 2 119 3 narP Nitrate/nitrite response regulator protein homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q0PVB3 1.36e-08 54 28 2 119 2 RR7 Two-component response regulator ORR7 Oryza sativa subsp. japonica
P39663 1.55e-08 54 31 3 119 1 sphR Alkaline phosphatase synthesis transcriptional regulatory protein SphR Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P39486 1.58e-08 54 28 3 123 3 dctR Probable C4-dicarboxylate response regulator DctR Priestia megaterium
Q2HWG0 1.59e-08 52 29 2 118 2 RR13 Two-component response regulator ORR13 Oryza sativa subsp. japonica
P0A4H8 1.75e-08 53 27 3 123 3 ciaR Transcriptional regulatory protein CiaR Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A4H7 1.75e-08 53 27 3 123 3 ciaR Transcriptional regulatory protein CiaR Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
A1SMR4 1.79e-08 54 31 3 125 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Nocardioides sp. (strain ATCC BAA-499 / JS614)
P13632 1.93e-08 54 32 3 121 1 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Rhizobium meliloti (strain 1021)
Q39QJ2 2.12e-08 54 34 2 117 3 cheB5 Protein-glutamate methylesterase/protein-glutamine glutaminase 5 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
E0X9C7 2.26e-08 54 28 1 121 1 todS Sensor histidine kinase TodS Pseudomonas putida (strain DOT-T1E)
Q2SFK0 2.31e-08 54 31 2 106 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Hahella chejuensis (strain KCTC 2396)
P9WGM1 2.32e-08 53 31 2 104 1 prrA Transcriptional regulatory protein PrrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM0 2.32e-08 53 31 2 104 3 prrA Transcriptional regulatory protein PrrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Z7 2.32e-08 53 31 2 104 3 prrA Transcriptional regulatory protein PrrA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q67P67 2.32e-08 54 34 3 111 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
P29369 2.4e-08 53 32 4 121 3 agmR Glycerol metabolism activator Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O29221 2.4e-08 54 36 3 108 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
P10046 2.42e-08 54 33 4 119 3 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Rhizobium leguminosarum
P32040 2.5e-08 53 30 3 113 3 SYNPCC7002_A0851 Probable transcriptional regulatory protein SYNPCC7002_A0851 Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
P96602 2.5e-08 53 27 2 123 3 dctR Probable C4-dicarboxylate response regulator DctR Bacillus subtilis (strain 168)
P52940 2.6e-08 53 30 3 126 3 spo0A Stage 0 sporulation protein A homolog Clostridium pasteurianum
P44895 2.68e-08 53 33 3 120 3 cpxR Transcriptional regulatory protein CpxR homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8CQK0 2.69e-08 53 30 2 107 3 walR Transcriptional regulatory protein WalR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HK18 2.69e-08 53 30 2 107 3 walR Transcriptional regulatory protein WalR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8GP20 2.81e-08 53 33 3 104 1 rssB Swarming motility regulation protein RssB Serratia marcescens
Q2SPQ1 2.81e-08 53 31 4 131 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Hahella chejuensis (strain KCTC 2396)
Q7A216 2.98e-08 53 30 2 107 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MW2)
Q9RDT5 2.98e-08 53 30 2 107 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus
A8YYU1 2.98e-08 53 30 2 107 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain USA300 / TCH1516)
Q6GD72 2.98e-08 53 30 2 107 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MSSA476)
Q6GKS7 2.98e-08 53 30 2 107 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MRSA252)
Q7A8E1 2.98e-08 53 30 2 107 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain N315)
Q99XF3 2.98e-08 53 30 2 107 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QD57 2.98e-08 53 30 2 107 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Newman)
Q5HJX7 2.98e-08 53 30 2 107 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain COL)
Q2YUQ3 2.98e-08 53 30 2 107 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5INQ9 2.98e-08 53 30 2 107 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain JH9)
Q2G2U6 2.98e-08 53 30 2 107 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FKN8 2.98e-08 53 30 2 107 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain USA300)
A6TXG8 2.98e-08 53 30 2 107 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain JH1)
A7WWQ5 2.98e-08 53 30 2 107 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Mu3 / ATCC 700698)
P0AED6 3.02e-08 53 31 2 105 3 uvrY Response regulator UvrY Shigella flexneri
P0AED5 3.02e-08 53 31 2 105 1 uvrY Response regulator UvrY Escherichia coli (strain K12)
Q8FW53 3.11e-08 51 27 1 104 3 divK Polar-differentiation response regulator DivK Brucella suis biovar 1 (strain 1330)
A9WYT1 3.11e-08 51 27 1 104 3 divK Polar-differentiation response regulator DivK Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VUU3 3.11e-08 51 27 1 104 3 divK Polar-differentiation response regulator DivK Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8YC73 3.11e-08 51 27 1 104 3 divK Polar-differentiation response regulator DivK Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A9MBQ2 3.11e-08 51 27 1 104 3 divK Polar-differentiation response regulator DivK Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q7BBW0 3.11e-08 51 27 1 104 1 divK Polar-differentiation response regulator DivK Brucella abortus biovar 1 (strain 9-941)
Q2YKN1 3.11e-08 51 27 1 104 3 divK Polar-differentiation response regulator DivK Brucella abortus (strain 2308)
B2SB45 3.11e-08 51 27 1 104 3 divK Polar-differentiation response regulator DivK Brucella abortus (strain S19)
A5W4E3 3.17e-08 53 28 1 121 1 todS Sensor histidine kinase TodS Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
P0ACZ8 3.41e-08 53 27 3 122 1 cusR Transcriptional regulatory protein CusR Escherichia coli (strain K12)
P0ACZ9 3.41e-08 53 27 3 122 3 cusR Transcriptional regulatory protein CusR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AD00 3.41e-08 53 27 3 122 3 cusR Transcriptional regulatory protein CusR Escherichia coli O157:H7
Q2WAJ8 3.44e-08 53 35 4 114 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
P66797 3.62e-08 53 31 2 105 3 uvrY Response regulator UvrY Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P66798 3.62e-08 53 31 2 105 3 uvrY Response regulator UvrY Escherichia coli O157:H7
A1A699 3.77e-08 53 31 4 138 1 HK6 Probable histidine kinase 6 Oryza sativa subsp. japonica
Q4LAJ9 3.79e-08 53 30 2 107 3 walR Transcriptional regulatory protein WalR Staphylococcus haemolyticus (strain JCSC1435)
O87717 3.96e-08 53 33 3 127 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
A6X580 4.01e-08 51 27 1 104 3 divK Polar-differentiation response regulator DivK Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q2RAP3 4.1e-08 52 27 2 120 2 RR9 Two-component response regulator ORR9 Oryza sativa subsp. japonica
Q4GZK2 4.1e-08 52 27 2 120 2 RR9 Two-component response regulator ORR9 Oryza sativa subsp. indica
Q5A4X5 4.11e-08 53 29 2 114 3 SKN7 Transcription factor SKN7 Candida albicans (strain SC5314 / ATCC MYA-2876)
P23747 4.16e-08 53 32 2 111 1 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O58192 5.02e-08 53 29 3 114 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
P58253 5.28e-08 53 29 3 126 3 spo0A Stage 0 sporulation protein A homolog Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
P0AFU5 5.72e-08 53 29 2 126 1 qseF Transcriptional regulatory protein QseF Escherichia coli O157:H7
P0AFU4 5.72e-08 53 29 2 126 1 glrR Transcriptional regulatory protein GlrR Escherichia coli (strain K12)
Q8XBS3 5.87e-08 52 31 2 106 2 qseB Transcriptional regulatory protein QseB Escherichia coli O157:H7
P62646 6.54e-08 53 29 3 110 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q9C5U2 6.63e-08 53 28 4 143 1 AHK2 Histidine kinase 2 Arabidopsis thaliana
Q52883 6.92e-08 52 36 3 111 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 1 operon Rhizobium meliloti (strain 1021)
Q9LZJ8 6.95e-08 52 28 3 108 2 ARR20 Putative two-component response regulator ARR20 Arabidopsis thaliana
Q23917 7.08e-08 53 28 4 127 1 regA 3',5'-cyclic-nucleotide phosphodiesterase regA Dictyostelium discoideum
P30843 7.58e-08 52 34 1 81 1 basR Transcriptional regulatory protein BasR Escherichia coli (strain K12)
P96126 7.68e-08 51 30 2 121 3 cheY Chemotaxis protein CheY Treponema pallidum (strain Nichols)
P52934 8.42e-08 52 33 2 92 1 spo0A Stage 0 sporulation protein A Geobacillus stearothermophilus
Q4GZK4 8.7e-08 52 27 2 119 2 RR7 Two-component response regulator ORR7 Oryza sativa subsp. indica
Q88RJ6 8.76e-08 52 33 2 104 3 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q88AQ2 8.85e-08 52 32 2 106 3 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q4A160 9.73e-08 52 30 2 107 3 walR Transcriptional regulatory protein WalR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
G0SB31 1.06e-07 52 32 3 111 1 SKN7 Transcription factor SKN7 Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)
Q2YV67 1.2e-07 52 28 2 119 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain bovine RF122 / ET3-1)
B8H358 1.21e-07 51 28 5 108 3 ctrA Cell cycle transcriptional regulator CtrA Caulobacter vibrioides (strain NA1000 / CB15N)
P0CAW8 1.21e-07 51 28 5 108 3 ctrA Cell cycle transcriptional regulator CtrA Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q8NYH3 1.21e-07 52 28 2 119 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain MW2)
Q6GCL1 1.21e-07 52 28 2 119 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain MSSA476)
Q67W50 1.21e-07 52 31 4 124 3 RR25 Two-component response regulator ORR25 Oryza sativa subsp. japonica
P60610 1.26e-07 52 28 2 119 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain N315)
P60609 1.26e-07 52 28 2 119 1 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HJB5 1.26e-07 52 28 2 119 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain COL)
P60611 1.26e-07 52 28 2 119 1 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FK09 1.26e-07 52 28 2 119 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain USA300)
Q6GK51 1.27e-07 51 28 2 119 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain MRSA252)
A6WZ81 1.28e-07 51 28 4 123 3 ctrA Cell cycle response regulator CtrA Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q8Q009 1.28e-07 52 36 4 108 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
P0AEV3 1.3e-07 52 33 2 104 3 rssB Regulator of RpoS Shigella flexneri
P0AEV1 1.3e-07 52 33 2 104 1 rssB Regulator of RpoS Escherichia coli (strain K12)
P0AEV2 1.3e-07 52 33 2 104 3 rssB Regulator of RpoS Escherichia coli O157:H7
Q9P896 1.36e-07 52 30 3 104 3 tcsA Two-component system protein A Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q7A7X9 1.36e-07 51 28 3 128 1 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain N315)
Q99X00 1.36e-07 51 28 3 128 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q6K8X6 1.39e-07 52 31 4 108 2 RR23 Two-component response regulator ORR23 Oryza sativa subsp. japonica
B8AEH1 1.39e-07 52 31 4 108 3 RR23 Two-component response regulator ORR23 Oryza sativa subsp. indica
P36556 1.43e-07 51 33 1 81 1 basR Transcriptional regulatory protein BasR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q2QXY3 1.44e-07 51 26 2 120 2 RR10 Two-component response regulator ORR10 Oryza sativa subsp. japonica
B8BLZ4 1.44e-07 51 26 2 120 2 RR10 Two-component response regulator ORR10 Oryza sativa subsp. indica
Q8FZ93 1.44e-07 51 28 4 123 1 ctrA Cell cycle response regulator CtrA Brucella suis biovar 1 (strain 1330)
B0CI76 1.44e-07 51 28 4 123 3 ctrA Cell cycle response regulator CtrA Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VRW9 1.44e-07 51 28 4 123 1 ctrA Cell cycle response regulator CtrA Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q7CNV1 1.44e-07 51 28 4 123 1 ctrA Cell cycle response regulator CtrA Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A9M708 1.44e-07 51 28 4 123 3 ctrA Cell cycle response regulator CtrA Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q9ZHS1 1.44e-07 51 28 4 123 1 ctrA Cell cycle response regulator CtrA Brucella abortus biovar 1 (strain 9-941)
Q2YQA4 1.44e-07 51 28 4 123 1 ctrA Cell cycle response regulator CtrA Brucella abortus (strain 2308)
B2S753 1.44e-07 51 28 4 123 3 ctrA Cell cycle response regulator CtrA Brucella abortus (strain S19)
Q54SK5 1.45e-07 52 28 4 124 3 dhkM Hybrid signal transduction histidine kinase M Dictyostelium discoideum
Q1IRH0 1.51e-07 52 35 3 107 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Koribacter versatilis (strain Ellin345)
Q5SML5 1.57e-07 52 30 4 108 2 RR22 Two-component response regulator ORR22 Oryza sativa subsp. japonica
B8B3I4 1.57e-07 52 30 4 108 3 RR22 Two-component response regulator ORR22 Oryza sativa subsp. indica
P42421 1.58e-07 51 26 2 110 3 yxdJ Transcriptional regulatory protein YxdJ Bacillus subtilis (strain 168)
Q888V8 1.59e-07 52 31 3 115 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
P66795 1.78e-07 51 31 2 106 3 qseB Transcriptional regulatory protein QseB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P66796 1.78e-07 51 31 2 106 3 qseB Transcriptional regulatory protein QseB Salmonella typhi
Q1MLG8 1.87e-07 51 35 3 111 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
P52929 1.88e-07 51 32 2 90 3 spo0A Stage 0 sporulation protein A (Fragment) Brevibacillus parabrevis
P62640 2.25e-07 51 29 3 119 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
P62638 2.42e-07 51 33 2 111 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
A5DLE2 2.49e-07 50 32 2 107 3 SRR1 Stress response regulator protein 1 Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324)
Q1MC14 2.52e-07 51 30 4 112 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q4L8L9 2.65e-07 50 29 2 124 3 hssR Heme response regulator HssR Staphylococcus haemolyticus (strain JCSC1435)
Q12YX1 2.77e-07 51 32 3 108 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M)
Q48ND9 2.9e-07 51 31 3 115 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
O83639 2.96e-07 51 29 4 115 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Treponema pallidum (strain Nichols)
Q2ILG8 2.96e-07 51 30 3 124 3 cheB6 Protein-glutamate methylesterase/protein-glutamine glutaminase 6 Anaeromyxobacter dehalogenans (strain 2CP-C)
Q8TLG9 3.05e-07 51 36 3 92 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
A8R3T0 3.11e-07 50 31 4 122 3 agmR Glycerol metabolism activator Pseudomonas putida
P23221 3.15e-07 50 32 2 102 3 fixJ Transcriptional regulatory protein FixJ Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q49VK3 3.54e-07 50 27 2 119 3 graR Response regulator protein GraR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q0AYL3 3.57e-07 50 33 4 109 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q10N34 3.9e-07 50 31 3 110 2 PRR73 Two-component response regulator-like PRR73 Oryza sativa subsp. japonica
A2XFB7 3.9e-07 50 31 3 110 2 PRR73 Two-component response regulator-like PRR73 Oryza sativa subsp. indica
Q9C5U1 3.93e-07 50 30 4 139 1 AHK3 Histidine kinase 3 Arabidopsis thaliana
P38889 4.12e-07 50 28 2 109 1 SKN7 Transcription factor SKN7 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q9KLK7 4.34e-07 50 31 3 119 1 luxQ Autoinducer 2 sensor kinase/phosphatase LuxQ Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q2KCH8 4.61e-07 50 35 3 111 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q47456 4.75e-07 50 28 2 105 3 pcoR Transcriptional regulatory protein PcoR Escherichia coli
P52076 4.76e-07 50 30 2 106 2 qseB Transcriptional regulatory protein QseB Escherichia coli (strain K12)
P9WMF9 5.35e-07 49 31 2 105 1 devR DNA-binding transcriptional activator DevR/DosR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMF8 5.35e-07 49 31 2 105 2 devR DNA-binding transcriptional activator DevR/DosR Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q54Q69 5.4e-07 50 27 2 123 3 dhkG Hybrid signal transduction histidine kinase G Dictyostelium discoideum
Q54YZ9 5.98e-07 50 28 3 107 3 dhkJ Hybrid signal transduction histidine kinase J Dictyostelium discoideum
Q4ZYD3 6.1e-07 50 30 3 115 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Pseudomonas syringae pv. syringae (strain B728a)
Q9WYN9 6.21e-07 50 31 3 116 1 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
O06978 6.43e-07 49 24 2 120 3 yvcP Uncharacterized transcriptional regulatory protein YvcP Bacillus subtilis (strain 168)
Q3IRR4 6.51e-07 50 26 3 131 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
O25408 6.57e-07 50 29 2 117 1 flgR Transcriptional regulatory protein FlgR Helicobacter pylori (strain ATCC 700392 / 26695)
Q6YVX7 6.77e-07 49 25 2 144 2 RR2 Two-component response regulator ORR2 Oryza sativa subsp. japonica
Q4GZK9 6.77e-07 49 25 2 144 2 RR2 Two-component response regulator ORR2 Oryza sativa subsp. indica
O07528 7.44e-07 49 26 3 108 3 yhcZ Uncharacterized transcriptional regulatory protein YhcZ Bacillus subtilis (strain 168)
P44918 7.88e-07 49 28 2 107 3 arcA Aerobic respiration control protein ArcA homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
O82798 8.07e-07 49 32 0 77 1 ARR4 Two-component response regulator ARR4 Arabidopsis thaliana
O80366 8.12e-07 49 25 2 135 1 ARR9 Two-component response regulator ARR9 Arabidopsis thaliana
Q0D3B6 8.18e-07 50 27 2 112 2 PRR37 Two-component response regulator-like PRR37 Oryza sativa subsp. japonica
Q9ZWS6 8.29e-07 48 27 3 122 1 ARR6 Two-component response regulator ARR6 Arabidopsis thaliana
P0DMI2 8.32e-07 49 37 1 80 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R4K0 8.32e-07 49 37 1 80 1 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q8NYJ9 8.42e-07 49 29 4 128 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain MW2)
Q6GCQ3 8.42e-07 49 29 4 128 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain MSSA476)
Q6GK93 8.42e-07 49 29 4 128 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain MRSA252)
Q5HJF7 8.42e-07 49 29 4 128 2 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain COL)
Q2G1E1 8.42e-07 49 29 4 128 1 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FK47 8.42e-07 49 29 4 128 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain USA300)
Q2YV56 8.5e-07 49 29 4 128 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain bovine RF122 / ET3-1)
A1A697 8.58e-07 50 29 4 124 2 HK5 Probable histidine kinase 5 Oryza sativa subsp. japonica
A2YQ93 8.67e-07 50 27 2 112 2 PRR37 Two-component response regulator-like PRR37 Oryza sativa subsp. indica
P37599 9.3e-07 49 27 1 93 1 cheV Chemotaxis protein CheV Bacillus subtilis (strain 168)
P51343 9.78e-07 48 31 1 104 3 ycf29 Probable transcriptional regulator ycf29 Porphyra purpurea
Q8ZPP5 9.83e-07 49 30 3 118 1 ssrA Sensor histidine kinase SsrA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q0WPQ2 9.87e-07 49 28 4 128 1 ETR2 Ethylene receptor 2 Arabidopsis thaliana
O80365 1.02e-06 49 26 2 129 1 ARR8 Two-component response regulator ARR8 Arabidopsis thaliana
Q5V0B3 1.15e-06 49 29 2 107 1 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
P56644 1.18e-06 48 31 3 119 3 sgaR Probable transcriptional regulatory protein SgaR Hyphomicrobium methylovorum
Q689G6 1.18e-06 49 28 2 107 2 PRR95 Two-component response regulator-like PRR95 Oryza sativa subsp. japonica
P13800 1.19e-06 48 28 3 124 1 degU Transcriptional regulatory protein DegU Bacillus subtilis (strain 168)
O25337 1.19e-06 49 34 2 105 1 cheV2 Chemotaxis protein CheV2 Helicobacter pylori (strain ATCC 700392 / 26695)
Q9KSB1 1.21e-06 49 27 0 92 1 VC_1348 Probable cyclic di-GMP phosphodiesterase VC_1348 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q1CWZ9 1.21e-06 49 34 3 123 3 cheB5 Protein-glutamate methylesterase/protein-glutamine glutaminase 5 Myxococcus xanthus (strain DK1622)
P54443 1.29e-06 48 31 4 115 3 yrkP Uncharacterized transcriptional regulatory protein YrkP Bacillus subtilis (strain 168)
Q6BGW4 1.33e-06 48 29 1 108 3 SRR1 Stress response regulator protein 1 Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968)
Q9K998 1.37e-06 48 28 2 108 3 dctR Probable C4-dicarboxylate response regulator DctR Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q7MM78 1.38e-06 49 23 2 117 3 luxO Regulatory protein LuxO Vibrio vulnificus (strain YJ016)
Q8CWJ5 1.38e-06 49 23 2 117 3 luxO Regulatory protein LuxO Vibrio vulnificus (strain CMCP6)
O34903 1.38e-06 48 28 3 117 3 ykoG Uncharacterized transcriptional regulatory protein YkoG Bacillus subtilis (strain 168)
Q9SB04 1.41e-06 48 28 3 125 1 ARR5 Two-component response regulator ARR5 Arabidopsis thaliana
Q6GJ11 1.43e-06 48 24 2 122 3 graR Response regulator protein GraR Staphylococcus aureus (strain MRSA252)
Q7A1L2 1.45e-06 48 24 2 122 3 graR Response regulator protein GraR Staphylococcus aureus (strain MW2)
Q6GBH1 1.45e-06 48 24 2 122 3 graR Response regulator protein GraR Staphylococcus aureus (strain MSSA476)
Q99VW2 1.45e-06 48 24 2 122 3 graR Response regulator protein GraR Staphylococcus aureus (strain N315)
A5IQL2 1.45e-06 48 24 2 122 3 graR Response regulator protein GraR Staphylococcus aureus (strain JH9)
A6TZD6 1.45e-06 48 24 2 122 3 graR Response regulator protein GraR Staphylococcus aureus (strain JH1)
A7WZC3 1.45e-06 48 24 2 122 3 graR Response regulator protein GraR Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q55E44 1.49e-06 49 28 3 118 3 dhkE Hybrid signal transduction histidine kinase E Dictyostelium discoideum
Q2YSS2 1.49e-06 48 24 2 122 3 graR Response regulator protein GraR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q932F1 1.51e-06 48 24 2 122 1 graR Response regulator protein GraR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q8CQ37 1.55e-06 48 23 2 122 3 graR Response regulator protein GraR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HR81 1.55e-06 48 23 2 122 3 graR Response regulator protein GraR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
A8Z181 1.55e-06 48 24 2 122 3 graR Response regulator protein GraR Staphylococcus aureus (strain USA300 / TCH1516)
A6QEW8 1.55e-06 48 24 2 122 3 graR Response regulator protein GraR Staphylococcus aureus (strain Newman)
Q5HI09 1.55e-06 48 24 2 122 1 graR Response regulator protein GraR Staphylococcus aureus (strain COL)
Q2G0E0 1.55e-06 48 24 2 122 1 graR Response regulator protein GraR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIY0 1.55e-06 48 24 2 122 3 graR Response regulator protein GraR Staphylococcus aureus (strain USA300)
P0AEC5 1.75e-06 48 29 4 119 1 barA Signal transduction histidine-protein kinase BarA Escherichia coli (strain K12)
P0AEC6 1.75e-06 48 29 4 119 1 barA Signal transduction histidine-protein kinase BarA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEC7 1.75e-06 48 29 4 119 3 barA Signal transduction histidine-protein kinase BarA Escherichia coli O157:H7
P69228 1.78e-06 48 22 2 120 1 baeR Transcriptional regulatory protein BaeR Escherichia coli (strain K12)
P69229 1.78e-06 48 22 2 120 1 baeR Transcriptional regulatory protein BaeR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q9ZWS9 1.79e-06 48 34 0 63 1 ARR3 Two-component response regulator ARR3 Arabidopsis thaliana
P62636 1.8e-06 48 29 4 130 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q5HPC3 1.8e-06 48 31 3 116 3 arlR Response regulator ArlR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q5SML4 1.81e-06 48 29 4 122 2 HK2 Probable histidine kinase 2 Oryza sativa subsp. japonica
A2YA15 1.81e-06 48 29 4 122 3 HK2 Probable histidine kinase 2 Oryza sativa subsp. indica
Q31HL9 1.81e-06 48 33 3 108 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q9HUI3 1.91e-06 48 29 2 120 3 aruS Sensor histidine kinase AruS Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O34534 1.94e-06 48 30 3 103 1 citT Transcriptional regulatory protein CitT Bacillus subtilis (strain 168)
P0A9Q4 2e-06 48 29 2 105 3 arcA Aerobic respiration control protein ArcA Shigella flexneri
P0A9Q1 2e-06 48 29 2 105 1 arcA Aerobic respiration control protein ArcA Escherichia coli (strain K12)
P0A9Q2 2e-06 48 29 2 105 3 arcA Aerobic respiration control protein ArcA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9Q3 2e-06 48 29 2 105 3 arcA Aerobic respiration control protein ArcA Escherichia coli O157:H7
P59342 2.05e-06 48 29 4 119 3 barA Signal transduction histidine-protein kinase BarA Shigella flexneri
P26762 2.11e-06 48 33 2 122 3 bvgS Virulence sensor protein BvgS Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q311M8 2.25e-06 48 34 2 84 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q3S4A7 2.26e-06 48 26 4 146 1 AHK5 Histidine kinase 5 Arabidopsis thaliana
Q0A9Z5 2.34e-06 48 31 2 107 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
P40330 2.37e-06 48 33 2 122 3 bvgS Virulence sensor protein BvgS Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q8CP82 2.43e-06 48 31 3 116 3 arlR Response regulator ArlR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q04849 2.68e-06 48 30 4 107 3 ntrX Nitrogen assimilation regulatory protein NtrX Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q8PX96 2.88e-06 48 28 4 125 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q1RJS1 2.9e-06 48 34 4 105 3 RBE_0312 Putative response regulator NtrX-like Rickettsia bellii (strain RML369-C)
P62645 2.9e-06 48 29 2 111 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 3 operon Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
C5M3F1 2.94e-06 48 28 1 110 3 SRR1 Stress response regulator protein 1 Candida tropicalis (strain ATCC MYA-3404 / T1)
P0C5S5 2.95e-06 48 23 2 117 3 luxO Luminescence regulatory protein LuxO Vibrio harveyi

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS08115
Feature type CDS
Gene cheY
Product chemotaxis response regulator CheY
Location 1773210 - 1773599 (strand: -1)
Length 390 (nucleotides) / 129 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_480
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00072 Response regulator receiver domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0784 Signal transduction mechanisms (T) T CheY-like REC (receiver) domain, includes chemotaxis protein CheY and sporulation regulator Spo0F

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03413 two-component system, chemotaxis family, chemotaxis protein CheY Two-component system
Bacterial chemotaxis
-

Virulence factor Annotation(s)

VF gene ID Protein VF ID Category
VFG043206 chemotaxis regulatory protein CheY VF0394 Motility

Protein Sequence

MASKDLRFLVVDDFSTMRRIVRNLLKELGFMNVEEAEDGADALAKLQSSAYDFVITDWNMPNMDGLELLKNIRSDAGLATLPVLMVTAEAKKENIIAAAQSGASGYVVKPFTAAILEEKLNKIFEKLGI

Flanking regions ( +/- flanking 50bp)

GTTTAAACAGCAACACAGTAATTTGCCAATATATTTTGAAGGAGTTTTCAATGGCAAGTAAGGATCTGAGATTTTTAGTGGTTGATGATTTTTCAACAATGCGCCGCATCGTTCGTAATTTACTAAAGGAGTTAGGATTTATGAACGTAGAAGAAGCAGAAGATGGTGCTGACGCGTTAGCCAAGTTACAGAGTTCGGCATATGATTTTGTTATCACCGATTGGAATATGCCCAATATGGATGGGTTAGAGTTGCTGAAGAATATTCGTAGTGACGCAGGGCTTGCAACGCTTCCCGTTCTGATGGTGACCGCCGAAGCGAAAAAAGAAAATATTATTGCTGCTGCGCAATCAGGAGCAAGTGGATATGTTGTTAAACCTTTTACTGCAGCCATTCTTGAAGAAAAACTCAATAAAATTTTTGAAAAACTGGGCATCTAAGGAGTCGCAATGAGTGGGGATCCAATTATGCCGAAAGATAATGTCGAAAT