Homologs in group_556

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00765 FBDBKF_00765 100.0 Morganella morganii S1 cheY chemotaxis response regulator CheY
EHELCC_00780 EHELCC_00780 100.0 Morganella morganii S2 cheY chemotaxis response regulator CheY
LHKJJB_04195 LHKJJB_04195 100.0 Morganella morganii S3 cheY chemotaxis response regulator CheY
HKOGLL_02850 HKOGLL_02850 100.0 Morganella morganii S5 cheY chemotaxis response regulator CheY
F4V73_RS06765 F4V73_RS06765 99.2 Morganella psychrotolerans cheY chemotaxis response regulator CheY
PMI_RS08115 PMI_RS08115 78.3 Proteus mirabilis HI4320 cheY chemotaxis response regulator CheY

Distribution of the homologs in the orthogroup group_556

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_556

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q93P00 9.95e-75 221 82 0 129 3 cheY Chemotaxis protein CheY Yersinia enterocolitica
Q8D0P1 7.09e-74 218 82 0 129 3 cheY Chemotaxis protein CheY Yersinia pestis
P0A2D5 7.09e-74 218 80 0 129 1 cheY Chemotaxis protein CheY Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2D6 7.09e-74 218 80 0 129 3 cheY Chemotaxis protein CheY Salmonella typhi
P0AE69 1.23e-73 218 81 0 129 3 cheY Chemotaxis protein CheY Shigella flexneri
P0AE67 1.23e-73 218 81 0 129 1 cheY Chemotaxis protein CheY Escherichia coli (strain K12)
P0AE68 1.23e-73 218 81 0 129 3 cheY Chemotaxis protein CheY Escherichia coli O157:H7
Q8FGP6 3.05e-73 217 80 0 129 3 cheY Chemotaxis protein CheY Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q9FAD7 3.19e-72 214 79 0 129 3 cheY Chemotaxis protein CheY Enterobacter cloacae
Q9KQD5 1.18e-57 177 63 0 124 1 VC_2065 Chemotaxis protein CheY-3 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A0A0H3AMJ9 1.18e-57 177 63 0 124 1 cheY-3 Chemotaxis protein CheY-3 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q51455 3.68e-53 166 59 0 122 3 cheY Chemotaxis protein CheY Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9ZM64 1.74e-37 126 50 1 120 3 cheY1 Chemotaxis protein CheY1 Helicobacter pylori (strain J99 / ATCC 700824)
P71403 4.45e-37 125 49 1 120 1 cheY1 Chemotaxis protein CheY1 Helicobacter pylori (strain ATCC 700392 / 26695)
A1W0A5 5.7e-34 117 45 1 120 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
P0C635 5.7e-34 117 45 1 120 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A8FMH1 5.7e-34 117 45 1 120 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
P24072 5.7e-20 82 38 1 117 1 cheY Chemotaxis protein CheY Bacillus subtilis (strain 168)
P0A4H5 3.44e-17 74 36 1 117 3 cheY Chemotaxis protein CheY Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
P0A4H6 3.44e-17 74 36 1 117 3 cheY Chemotaxis protein CheY Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q2KCH7 1.13e-16 73 31 0 122 3 cheY Probable chemotaxis protein CheY Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q54SP4 1.76e-15 74 37 2 121 2 dhkD Hybrid signal transduction histidine kinase D Dictyostelium discoideum
Q56312 2.3e-15 70 33 1 115 1 cheY Chemotaxis protein CheY Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
P0DMC5 3.49e-15 73 37 2 123 1 rcsC Sensor histidine kinase RcsC Escherichia coli (strain K12)
P58662 3.84e-15 73 38 2 123 3 rcsC Sensor histidine kinase RcsC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P45189 4.03e-15 72 30 2 119 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
B0R4K1 8.36e-15 68 39 2 103 1 cheY Chemotaxis protein CheY Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
P35163 8.71e-15 71 37 2 104 1 resD Transcriptional regulatory protein ResD Bacillus subtilis (strain 168)
P0DMC6 1.11e-14 72 37 2 123 1 rcsC Sensor histidine kinase RcsC Escherichia coli
P23620 1.27e-14 70 31 1 122 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q56128 1.37e-14 72 38 2 123 3 rcsC Sensor histidine kinase RcsC Salmonella typhi
P28835 3.06e-14 69 32 2 120 3 ycf27 Probable transcriptional regulator ycf27 Porphyridium aerugineum
P0AFJ5 3.46e-14 69 28 1 119 1 phoB Phosphate regulon transcriptional regulatory protein PhoB Escherichia coli (strain K12)
P0AFJ6 3.46e-14 69 28 1 119 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Escherichia coli O157:H7
P45607 3.53e-14 69 28 1 119 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Shigella flexneri
P45605 3.68e-14 69 29 1 120 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Klebsiella pneumoniae
P45606 3.76e-14 69 28 1 120 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Shigella dysenteriae
A6X580 4.05e-14 67 33 1 106 3 divK Polar-differentiation response regulator DivK Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q9TLQ4 9.21e-14 68 30 2 121 3 ycf27 Probable transcriptional regulator ycf27 Cyanidium caldarium
P18769 9.98e-14 69 36 1 108 1 frzE Gliding motility regulatory protein Myxococcus xanthus
A0PWB4 1.43e-13 67 38 4 120 3 mprA Response regulator MprA Mycobacterium ulcerans (strain Agy99)
O25153 1.53e-13 69 31 2 117 1 cheAY Sensor histidine kinase CheAY Helicobacter pylori (strain ATCC 700392 / 26695)
Q8Z333 2.05e-13 68 36 2 119 3 zraR Transcriptional regulatory protein ZraR Salmonella typhi
P25852 2.13e-13 68 36 2 119 1 zraR Transcriptional regulatory protein ZraR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8FW53 2.31e-13 65 32 1 106 3 divK Polar-differentiation response regulator DivK Brucella suis biovar 1 (strain 1330)
A9WYT1 2.31e-13 65 32 1 106 3 divK Polar-differentiation response regulator DivK Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VUU3 2.31e-13 65 32 1 106 3 divK Polar-differentiation response regulator DivK Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8YC73 2.31e-13 65 32 1 106 3 divK Polar-differentiation response regulator DivK Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A9MBQ2 2.31e-13 65 32 1 106 3 divK Polar-differentiation response regulator DivK Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q7BBW0 2.31e-13 65 32 1 106 1 divK Polar-differentiation response regulator DivK Brucella abortus biovar 1 (strain 9-941)
Q2YKN1 2.31e-13 65 32 1 106 3 divK Polar-differentiation response regulator DivK Brucella abortus (strain 2308)
B2SB45 2.31e-13 65 32 1 106 3 divK Polar-differentiation response regulator DivK Brucella abortus (strain S19)
Q82EB1 2.63e-13 67 30 2 126 3 cseB Transcriptional regulatory protein CseB Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q742C1 2.64e-13 67 37 4 120 3 mprA Response regulator MprA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QBQ9 2.64e-13 67 37 4 120 3 mprA Response regulator MprA Mycobacterium avium (strain 104)
Q9APD9 3e-13 68 33 2 124 3 zraR Transcriptional regulatory protein ZraR Klebsiella oxytoca
Q9ZEP4 3e-13 67 30 2 126 1 cseB Transcriptional regulatory protein CseB Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
O78428 3.21e-13 67 33 2 118 3 ycf27 Probable transcriptional regulator ycf27 Guillardia theta
Q4UU85 3.44e-13 68 28 1 121 1 rpfG Cyclic di-GMP phosphodiesterase response regulator RpfG Xanthomonas campestris pv. campestris (strain 8004)
Q1B3X8 3.74e-13 66 38 4 120 3 mprA Response regulator MprA Mycobacterium sp. (strain MCS)
A1UL70 3.74e-13 66 38 4 120 3 mprA Response regulator MprA Mycobacterium sp. (strain KMS)
A3Q5L9 3.74e-13 66 38 4 120 3 mprA Response regulator MprA Mycobacterium sp. (strain JLS)
A1KHB7 4.02e-13 66 37 4 120 3 mprA Response regulator MprA Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q7U0X4 4.02e-13 66 37 4 120 1 mprA Response regulator MprA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P46384 4.08e-13 64 34 3 110 1 pilG Protein PilG Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P30855 4.17e-13 68 32 2 122 1 evgS Sensor protein EvgS Escherichia coli (strain K12)
Q5L0L0 5.83e-13 67 41 4 112 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Geobacillus kaustophilus (strain HTA426)
P14375 5.85e-13 67 35 2 124 1 zraR Transcriptional regulatory protein ZraR Escherichia coli (strain K12)
P9WGM9 6.01e-13 66 37 4 120 1 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM8 6.01e-13 66 37 4 120 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U123 6.01e-13 66 37 4 120 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
A0R3I8 6.27e-13 66 36 4 120 1 mprA Response regulator MprA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q8X613 6.7e-13 67 35 2 124 3 zraR Transcriptional regulatory protein ZraR Escherichia coli O157:H7
Q1XDC9 7.39e-13 66 34 2 119 3 ycf27 Probable transcriptional regulator ycf27 Neopyropia yezoensis
P51358 9.56e-13 65 34 2 119 3 ycf27 Probable transcriptional regulator ycf27 Porphyra purpurea
A1TEL7 1.03e-12 65 37 4 120 3 mprA Response regulator MprA Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
P28257 1.28e-12 65 34 2 119 3 ycf27 Probable transcriptional regulator ycf27 Galdieria sulphuraria
Q9CD68 1.34e-12 65 36 4 120 3 mprA Response regulator MprA Mycobacterium leprae (strain TN)
P48259 1.45e-12 65 33 2 119 3 ycf27 Probable transcriptional regulator ycf27 Cyanophora paradoxa
Q9FPR6 1.78e-12 63 29 2 127 2 ARR17 Two-component response regulator ARR17 Arabidopsis thaliana
Q9I4F9 1.78e-12 64 30 2 121 1 phoP Two-component response regulator PhoP Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0C0F6 1.94e-12 66 33 3 121 1 rpfC Sensory/regulatory protein RpfC Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
P58402 1.97e-12 66 31 2 122 3 evgS Sensor protein EvgS Escherichia coli O157:H7
Q9KM66 2.68e-12 65 33 3 116 1 cqsS CAI-1 autoinducer sensor kinase/phosphatase CqsS Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P0C0F7 2.83e-12 65 33 3 121 1 rpfC Sensory/regulatory protein RpfC Xanthomonas campestris pv. campestris (strain 8004)
Q9KS59 3.49e-12 65 35 2 107 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
O69730 4.17e-12 63 35 2 110 1 tcrX Probable transcriptional regulatory protein TcrX Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q8DPL7 4.34e-12 63 32 4 119 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2UQ68 4.34e-12 63 32 4 119 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
A0A0H2ZN37 4.34e-12 63 32 4 119 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
A2XYV5 6.01e-12 62 29 2 116 2 RR6 Two-component response regulator ORR6 Oryza sativa subsp. indica
Q7XQA6 6.21e-12 62 29 2 116 2 RR6 Two-component response regulator ORR6 Oryza sativa subsp. japonica
Q6K9T0 7.6e-12 61 28 2 121 2 RR3 Two-component response regulator ORR3 Oryza sativa subsp. japonica
Q4GZK8 7.6e-12 61 28 2 121 2 RR3 Two-component response regulator ORR3 Oryza sativa subsp. indica
Q2HWG4 8.53e-12 63 33 1 114 2 RR1 Two-component response regulator ORR1 Oryza sativa subsp. japonica
Q4GZL0 8.89e-12 63 33 1 114 2 RR1 Two-component response regulator ORR1 Oryza sativa subsp. indica
Q5JF95 8.99e-12 63 35 3 114 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
T2KMF4 1.28e-11 63 32 2 117 3 BN863_21930 Histidine kinase P4 Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1)
O25154 1.38e-11 63 31 3 128 3 cheV3 Chemotaxis protein CheV3 Helicobacter pylori (strain ATCC 700392 / 26695)
Q04942 2.03e-11 62 27 2 120 1 afsQ1 Transcriptional regulatory protein AfsQ1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q47744 2.66e-11 61 32 2 123 3 vanRB Regulatory protein VanRB Enterococcus faecalis (strain ATCC 700802 / V583)
Q7G8V2 2.75e-11 61 30 3 121 1 ARR15 Two-component response regulator ARR15 Arabidopsis thaliana
Q9SHC2 2.98e-11 60 28 2 129 1 ARR16 Two-component response regulator ARR16 Arabidopsis thaliana
A7N6S2 3.42e-11 62 28 4 135 1 cqsS CAI-1 autoinducer sensor kinase/phosphatase CqsS Vibrio campbellii (strain ATCC BAA-1116)
P96126 5e-11 59 34 2 119 3 cheY Chemotaxis protein CheY Treponema pallidum (strain Nichols)
P72781 5.46e-11 60 28 0 115 1 rre1 Response regulator Rre1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q7A0U4 6.1e-11 60 30 2 104 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MW2)
Q9L524 6.1e-11 60 30 2 104 2 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus
Q6G972 6.1e-11 60 30 2 104 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MSSA476)
Q6GGK6 6.1e-11 60 30 2 104 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MRSA252)
Q7A5H6 6.1e-11 60 30 2 104 1 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain N315)
Q7A2R6 6.1e-11 60 30 2 104 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HFT0 6.1e-11 60 30 2 104 2 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain COL)
Q2FY79 6.1e-11 60 30 2 104 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain NCTC 8325 / PS 47)
P13792 7.95e-11 60 32 2 106 1 phoP Alkaline phosphatase synthesis transcriptional regulatory protein PhoP Bacillus subtilis (strain 168)
P9WGM7 8.14e-11 60 29 2 105 1 mtrA DNA-binding response regulator MtrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM6 8.14e-11 60 29 2 105 3 mtrA DNA-binding response regulator MtrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Z5 8.14e-11 60 29 2 105 3 mtrA DNA-binding response regulator MtrA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q93CB8 8.38e-11 60 29 2 105 3 mtrA DNA-binding response regulator MtrA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q9CCJ2 8.47e-11 60 29 2 105 3 mtrA DNA-binding response regulator MtrA Mycobacterium leprae (strain TN)
O25918 9.85e-11 60 32 3 117 3 crdR Transcriptional regulatory protein CrdR Helicobacter pylori (strain ATCC 700392 / 26695)
P0A4I0 1.02e-10 60 33 2 108 3 dltR Transcriptional regulatory protein DltR Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P0A4H9 1.02e-10 60 33 2 108 3 dltR Transcriptional regulatory protein DltR Streptococcus agalactiae serotype III (strain NEM316)
P31802 1.15e-10 59 32 3 131 3 narP Nitrate/nitrite response regulator protein NarP Escherichia coli (strain K12)
Q10WZ6 1.26e-10 60 37 3 108 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Trichodesmium erythraeum (strain IMS101)
A0QTK2 1.44e-10 59 30 2 105 1 mtrA DNA-binding response regulator MtrA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q99U73 1.72e-10 59 29 2 104 3 arlR Response regulator ArlR Staphylococcus aureus (strain N315)
P0C001 2.06e-10 59 29 2 104 3 arlR Response regulator ArlR Staphylococcus aureus (strain MW2)
Q6G9E6 2.06e-10 59 29 2 104 3 arlR Response regulator ArlR Staphylococcus aureus (strain MSSA476)
Q6GGZ3 2.06e-10 59 29 2 104 3 arlR Response regulator ArlR Staphylococcus aureus (strain MRSA252)
P0C000 2.06e-10 59 29 2 104 3 arlR Response regulator ArlR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HG04 2.06e-10 59 29 2 104 3 arlR Response regulator ArlR Staphylococcus aureus (strain COL)
Q2YY03 2.06e-10 59 29 2 104 3 arlR Response regulator ArlR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q9KJN4 2.06e-10 59 29 2 104 1 arlR Response regulator ArlR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH23 2.06e-10 59 29 2 104 3 arlR Response regulator ArlR Staphylococcus aureus (strain USA300)
P21866 2.48e-10 58 30 2 120 1 kdpE KDP operon transcriptional regulatory protein KdpE Escherichia coli (strain K12)
P0AFB8 2.54e-10 60 35 2 102 1 glnG DNA-binding transcriptional regulator NtrC Escherichia coli (strain K12)
P0AFB9 2.54e-10 60 35 2 102 3 glnG DNA-binding transcriptional regulator NtrC Escherichia coli O157:H7
P9WGM3 2.81e-10 58 33 2 112 1 pdtaR Transcriptional regulatory protein PdtaR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM2 2.81e-10 58 33 2 112 3 pdtaR Transcriptional regulatory protein PdtaR Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q6H468 2.91e-10 57 27 2 119 2 RR11 Two-component response regulator ORR11 Oryza sativa subsp. japonica
B8AFR8 2.91e-10 57 27 2 119 3 RR11 Two-component response regulator ORR11 Oryza sativa subsp. indica
P9WGM1 3.47e-10 58 31 1 97 1 prrA Transcriptional regulatory protein PrrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM0 3.47e-10 58 31 1 97 3 prrA Transcriptional regulatory protein PrrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Z7 3.47e-10 58 31 1 97 3 prrA Transcriptional regulatory protein PrrA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q50136 3.57e-10 58 31 1 97 3 prrA Transcriptional regulatory protein PrrA Mycobacterium leprae (strain TN)
Q689G6 3.8e-10 59 31 2 120 2 PRR95 Two-component response regulator-like PRR95 Oryza sativa subsp. japonica
Q2HWH1 4.1e-10 57 26 2 119 2 RR5 Two-component response regulator ORR5 Oryza sativa subsp. japonica
Q4GZK6 4.1e-10 57 26 2 119 2 RR5 Two-component response regulator ORR5 Oryza sativa subsp. indica
Q23917 4.1e-10 59 31 4 127 1 regA 3',5'-cyclic-nucleotide phosphodiesterase regA Dictyostelium discoideum
Q06065 4.11e-10 59 34 2 104 1 atoC Regulatory protein AtoC Escherichia coli (strain K12)
Q5N6V8 4.27e-10 59 30 3 123 3 RR26 Two-component response regulator ORR26 Oryza sativa subsp. japonica
P37478 4.84e-10 58 32 2 109 1 walR Transcriptional regulatory protein WalR Bacillus subtilis (strain 168)
Q9ZWS7 5.22e-10 57 26 2 121 1 ARR7 Two-component response regulator ARR7 Arabidopsis thaliana
Q39QJ2 6.59e-10 58 36 2 120 3 cheB5 Protein-glutamate methylesterase/protein-glutamine glutaminase 5 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
O25337 6.66e-10 58 35 2 103 1 cheV2 Chemotaxis protein CheV2 Helicobacter pylori (strain ATCC 700392 / 26695)
Q2SFK0 7.1e-10 58 34 2 108 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Hahella chejuensis (strain KCTC 2396)
Q31S42 7.82e-10 58 32 4 119 1 rpaA DNA-binding dual master transcriptional regulator RpaA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q49XM7 7.96e-10 57 30 2 103 3 arlR Response regulator ArlR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q9AE24 8.44e-10 57 31 2 107 3 rprY Transcriptional regulatory protein RprY Bacteroides fragilis (strain YCH46)
Q1IQS9 9.53e-10 58 35 3 113 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Koribacter versatilis (strain Ellin345)
P39486 9.53e-10 57 28 2 123 3 dctR Probable C4-dicarboxylate response regulator DctR Priestia megaterium
Q8L500 9.66e-10 58 29 3 124 1 APRR9 Two-component response regulator-like APRR9 Arabidopsis thaliana
P28787 1.06e-09 58 32 3 124 3 ntrC DNA-binding transcriptional regulator NtrC Proteus hauseri
P48359 1.13e-09 57 26 2 121 3 ycf29 Probable transcriptional regulator ycf29 Cyanophora paradoxa
P66797 1.22e-09 57 33 2 105 3 uvrY Response regulator UvrY Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P66798 1.22e-09 57 33 2 105 3 uvrY Response regulator UvrY Escherichia coli O157:H7
Q6AJV3 1.23e-09 57 37 4 114 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q1XDE4 1.25e-09 57 28 1 104 3 ycf29 Probable transcriptional regulator ycf29 Neopyropia yezoensis
A1A698 1.35e-09 58 32 4 137 2 HK4 Probable histidine kinase 4 Oryza sativa subsp. japonica
L7N689 1.51e-09 57 28 2 121 1 trcR Transcriptional regulatory protein TrcR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q9KA55 1.62e-09 57 32 3 108 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
O49397 1.64e-09 57 30 3 107 1 ARR10 Two-component response regulator ARR10 Arabidopsis thaliana
P50350 1.67e-09 57 31 2 115 3 chvI Transcriptional regulatory protein ChvI Rhizobium meliloti (strain 1021)
Q0PVB3 1.69e-09 56 27 2 118 2 RR7 Two-component response regulator ORR7 Oryza sativa subsp. japonica
Q9ZWJ9 1.7e-09 57 32 3 124 1 ARR2 Two-component response regulator ARR2 Arabidopsis thaliana
Q940D0 1.74e-09 57 31 3 128 1 ARR1 Two-component response regulator ARR1 Arabidopsis thaliana
P50351 1.82e-09 57 31 2 115 3 chvI Transcriptional regulatory protein ChvI Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q0AYL3 2.15e-09 57 37 4 109 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q9KSB1 2.42e-09 57 30 2 124 1 VC_1348 Probable cyclic di-GMP phosphodiesterase VC_1348 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q55890 2.73e-09 56 29 2 117 1 rpaA DNA-binding dual master transcriptional regulator RpaA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
G3XCY6 3.14e-09 56 23 1 126 1 gltR Transcriptional regulatory protein GltR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P41789 3.36e-09 56 34 2 102 1 glnG DNA-binding transcriptional regulator NtrC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P45709 3.62e-09 54 32 1 116 3 ccdB Protein CcdB Bacillus subtilis (strain 168)
Q9UYF3 3.66e-09 56 29 3 116 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Pyrococcus abyssi (strain GE5 / Orsay)
Q9FXD6 3.88e-09 56 32 3 107 1 ARR11 Two-component response regulator ARR11 Arabidopsis thaliana
P03029 4.41e-09 56 33 2 102 1 ntrC DNA-binding transcriptional regulator NtrC Klebsiella pneumoniae
Q83RR0 4.44e-09 55 28 2 106 3 phoP Virulence transcriptional regulatory protein PhoP Shigella flexneri
Q8CXZ9 4.44e-09 55 28 2 106 3 phoP Transcriptional regulatory protein PhoP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AED6 4.46e-09 55 32 2 105 3 uvrY Response regulator UvrY Shigella flexneri
P0AED5 4.46e-09 55 32 2 105 1 uvrY Response regulator UvrY Escherichia coli (strain K12)
Q9I4N3 4.64e-09 56 34 3 116 1 fleR Response regulator protein FleR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q86AT9 4.66e-09 56 32 3 120 3 dhkI-1 Hybrid signal transduction histidine kinase I Dictyostelium discoideum
P62598 4.9e-09 56 29 3 107 2 ARR12 Two-component response regulator ARR12 Arabidopsis thaliana
A1SMR4 4.94e-09 56 31 3 125 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Nocardioides sp. (strain ATCC BAA-499 / JS614)
Q67P67 5.69e-09 55 35 3 110 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
P23836 5.84e-09 55 28 2 106 1 phoP Transcriptional regulatory protein PhoP Escherichia coli (strain K12)
B8GZM2 6.21e-09 55 30 1 110 1 pleD Response regulator PleD Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A5I5 6.21e-09 55 30 1 110 1 pleD Response regulator PleD Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P37599 6.97e-09 55 29 1 115 1 cheV Chemotaxis protein CheV Bacillus subtilis (strain 168)
Q52990 7.19e-09 55 28 0 75 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Rhizobium meliloti (strain 1021)
Q6H805 7.7e-09 55 30 3 107 2 RR24 Two-component response regulator ORR24 Oryza sativa subsp. japonica
A2X1N2 7.7e-09 55 30 3 107 3 RR24 Two-component response regulator ORR24 Oryza sativa subsp. indica
Q8H7S7 8.02e-09 55 27 3 123 2 RR21 Two-component response regulator ORR21 Oryza sativa subsp. japonica
A2XE31 8.02e-09 55 27 3 123 3 RR21 Two-component response regulator ORR21 Oryza sativa subsp. indica
Q8Q009 8.1e-09 55 37 2 102 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q54SK5 8.1e-09 55 29 4 124 3 dhkM Hybrid signal transduction histidine kinase M Dictyostelium discoideum
Q7NSI8 9.3e-09 55 30 4 130 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q6LA42 1.01e-08 55 27 2 108 1 APRR5 Two-component response regulator-like APRR5 Arabidopsis thaliana
G0SB31 1.07e-08 55 33 3 106 1 SKN7 Transcription factor SKN7 Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)
Q2RRX2 1.1e-08 55 35 2 104 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q4GZK4 1.11e-08 54 27 2 118 2 RR7 Two-component response regulator ORR7 Oryza sativa subsp. indica
Q07783 1.13e-08 54 28 2 117 3 chvI Transcriptional regulatory protein ChvI Rhizobium radiobacter
Q8KIY1 1.23e-08 55 27 1 115 1 tmoS Sensor histidine kinase TmoS Pseudomonas mendocina
P24908 1.24e-08 54 32 2 104 1 PA0034 Putative transcriptional regulator Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O29221 1.32e-08 55 33 1 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
E0X9C7 1.37e-08 55 27 1 115 1 todS Sensor histidine kinase TodS Pseudomonas putida (strain DOT-T1E)
Q75KW7 1.38e-08 52 31 4 132 3 RR41 Two-component response regulator ORR41 Oryza sativa subsp. japonica
P06628 1.38e-08 52 31 2 103 1 spo0F Sporulation initiation phosphotransferase F Bacillus subtilis (strain 168)
Q2HWG1 1.5e-08 52 28 3 119 2 RR12 Two-component response regulator ORR12 Oryza sativa subsp. japonica
Q8GVV6 1.56e-08 52 30 3 106 2 RR8 Two-component response regulator ORR8 Oryza sativa subsp. japonica
Q4GZK3 1.56e-08 52 30 3 106 2 RR8 Two-component response regulator ORR8 Oryza sativa subsp. indica
P52942 1.63e-08 52 31 2 103 3 spo0F Sporulation initiation phosphotransferase F Bacillus thuringiensis subsp. kurstaki
Q55933 1.69e-08 54 29 3 117 1 rppA Response regulator RppA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q4L6C6 1.77e-08 53 28 2 105 3 arlR Response regulator ArlR Staphylococcus haemolyticus (strain JCSC1435)
A5W4E3 1.83e-08 54 27 1 115 1 todS Sensor histidine kinase TodS Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q8X738 1.85e-08 53 28 2 106 3 phoP Transcriptional regulatory protein PhoP Escherichia coli O157:H7
Q2FWH6 1.92e-08 53 29 2 101 1 kdpE Transcriptional regulatory protein KdpE Staphylococcus aureus (strain NCTC 8325 / PS 47)
P31079 1.94e-08 53 26 2 127 3 petR Protein PetR Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
O14002 2.03e-08 54 31 3 111 3 mak2 Peroxide stress-activated histidine kinase mak2 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P26275 2.07e-08 53 33 3 119 3 algR Positive alginate biosynthesis regulatory protein Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0DM78 2.09e-08 53 29 2 106 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
F5ZP95 2.09e-08 53 29 2 106 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain ATCC 68169 / UK-1)
E1WFA1 2.09e-08 53 29 2 106 2 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain SL1344)
Q8Z7H2 2.09e-08 53 29 2 106 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhi
D0ZV90 2.09e-08 53 29 2 106 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain 14028s / SGSC 2262)
Q5PMJ1 2.09e-08 53 29 2 106 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella paratyphi A (strain ATCC 9150 / SARB42)
P43501 2.12e-08 52 27 1 117 3 pilH Protein PilH Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9LYP5 2.4e-08 54 29 5 122 2 ARR21 Putative two-component response regulator ARR21 Arabidopsis thaliana
P76340 2.56e-08 53 28 3 134 1 hprR Transcriptional regulatory protein HprR Escherichia coli (strain K12)
Q8CQK0 2.63e-08 53 32 2 105 3 walR Transcriptional regulatory protein WalR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HK18 2.63e-08 53 32 2 105 3 walR Transcriptional regulatory protein WalR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P58253 2.65e-08 53 30 3 126 3 spo0A Stage 0 sporulation protein A homolog Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q55E44 2.65e-08 54 28 3 120 3 dhkE Hybrid signal transduction histidine kinase E Dictyostelium discoideum
Q5HLN2 2.66e-08 53 29 3 127 3 hssR Heme response regulator HssR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P62638 2.71e-08 53 34 2 110 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q8DN02 2.75e-08 53 31 3 122 1 rr06 Response regulator RR06 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2ZNF6 2.75e-08 53 31 3 122 1 rr06 Response regulator RR06 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q7A216 2.82e-08 53 32 2 105 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MW2)
Q9RDT5 2.82e-08 53 32 2 105 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus
A8YYU1 2.82e-08 53 32 2 105 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain USA300 / TCH1516)
Q6GD72 2.82e-08 53 32 2 105 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MSSA476)
Q6GKS7 2.82e-08 53 32 2 105 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MRSA252)
Q7A8E1 2.82e-08 53 32 2 105 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain N315)
Q99XF3 2.82e-08 53 32 2 105 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QD57 2.82e-08 53 32 2 105 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Newman)
Q5HJX7 2.82e-08 53 32 2 105 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain COL)
Q2YUQ3 2.82e-08 53 32 2 105 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5INQ9 2.82e-08 53 32 2 105 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain JH9)
Q2G2U6 2.82e-08 53 32 2 105 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FKN8 2.82e-08 53 32 2 105 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain USA300)
A6TXG8 2.82e-08 53 32 2 105 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain JH1)
A7WWQ5 2.82e-08 53 32 2 105 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q7D9K0 2.96e-08 53 32 2 106 3 tcrA Transcriptional regulatory protein TcrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O07776 2.96e-08 53 32 2 106 1 tcrA Transcriptional regulatory protein TcrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
O58192 3e-08 53 28 3 116 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q9LKL2 3.03e-08 53 29 2 108 1 APRR1 Two-component response regulator-like APRR1 Arabidopsis thaliana
Q8CN92 3.07e-08 53 29 3 127 3 hssR Heme response regulator HssR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q10N34 3.2e-08 53 30 3 113 2 PRR73 Two-component response regulator-like PRR73 Oryza sativa subsp. japonica
A2XFB7 3.2e-08 53 30 3 113 2 PRR73 Two-component response regulator-like PRR73 Oryza sativa subsp. indica
Q1MLG8 3.24e-08 53 37 3 105 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q2HWG0 3.45e-08 51 27 3 119 2 RR13 Two-component response regulator ORR13 Oryza sativa subsp. japonica
P94504 3.55e-08 53 27 3 125 3 yvrH Transcriptional regulatory protein YvrH Bacillus subtilis (strain 168)
P45337 3.63e-08 53 28 2 102 3 qseB Transcriptional regulatory protein QseB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9SB04 3.82e-08 52 28 3 125 1 ARR5 Two-component response regulator ARR5 Arabidopsis thaliana
Q04803 3.93e-08 53 28 2 115 3 pfeR Transcriptional activator protein PfeR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q4LAJ9 4.1e-08 53 32 2 105 3 walR Transcriptional regulatory protein WalR Staphylococcus haemolyticus (strain JCSC1435)
B8H358 4.38e-08 53 29 4 108 3 ctrA Cell cycle transcriptional regulator CtrA Caulobacter vibrioides (strain NA1000 / CB15N)
P0CAW8 4.38e-08 53 29 4 108 3 ctrA Cell cycle transcriptional regulator CtrA Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q5A872 4.47e-08 53 26 2 120 1 SLN1 Histidine protein kinase SLN1 Candida albicans (strain SC5314 / ATCC MYA-2876)
P96602 5e-08 52 28 2 123 3 dctR Probable C4-dicarboxylate response regulator DctR Bacillus subtilis (strain 168)
P9WGM5 5.05e-08 52 31 3 110 1 narL Probable transcriptional regulatory protein NarL Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM4 5.05e-08 52 31 3 110 3 narL Probable transcriptional regulatory protein NarL Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P51586 5.26e-08 51 31 1 105 3 None Uncharacterized 14.6 kDa protein in sodA1 3'region Leptolyngbya boryana
P51343 5.7e-08 52 30 1 105 3 ycf29 Probable transcriptional regulator ycf29 Porphyra purpurea
Q4L8V4 5.91e-08 52 31 2 121 3 lytR Sensory transduction protein LytR Staphylococcus haemolyticus (strain JCSC1435)
P0A4H2 6e-08 52 28 2 103 1 bvgA Virulence factors putative positive transcription regulator BvgA Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P0A4H4 6e-08 52 28 2 103 3 bvgA Virulence factors putative positive transcription regulator BvgA Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
P0A4H3 6e-08 52 28 2 103 3 bvgA Virulence factors putative positive transcription regulator BvgA Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q9M9B9 6.01e-08 53 32 6 115 2 ARR19 Putative two-component response regulator ARR19 Arabidopsis thaliana
P9WGL9 6.1e-08 52 28 2 122 1 regX3 Sensory transduction protein RegX3 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGL8 6.1e-08 52 28 2 122 2 regX3 Sensory transduction protein RegX3 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O07130 6.1e-08 52 28 2 122 1 regX3 Sensory transduction protein RegX3 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q12YX1 6.41e-08 53 35 3 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M)
Q2KCH8 6.51e-08 53 37 3 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
P52934 6.69e-08 52 33 2 95 1 spo0A Stage 0 sporulation protein A Geobacillus stearothermophilus
Q52883 6.78e-08 52 37 4 106 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 1 operon Rhizobium meliloti (strain 1021)
Q9F868 7.44e-08 52 28 2 120 1 regX3 Sensory transduction protein RegX3 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q02540 7.46e-08 52 25 2 121 1 copR Transcriptional activator protein CopR Pseudomonas syringae pv. tomato
Q67W50 7.93e-08 52 29 3 127 3 RR25 Two-component response regulator ORR25 Oryza sativa subsp. japonica
Q9ZWS6 8.2e-08 51 27 3 116 1 ARR6 Two-component response regulator ARR6 Arabidopsis thaliana
Q9ZWS9 8.23e-08 52 30 3 120 1 ARR3 Two-component response regulator ARR3 Arabidopsis thaliana
Q9F8D7 8.3e-08 52 29 3 129 3 gacS Sensor histidine kinase GacS Pseudomonas protegens (strain DSM 19095 / LMG 27888 / CFBP 6595 / CHA0)
P52940 8.47e-08 52 30 3 126 3 spo0A Stage 0 sporulation protein A homolog Clostridium pasteurianum
Q4A160 8.86e-08 52 32 2 105 3 walR Transcriptional regulatory protein WalR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q2YV67 9.5e-08 52 31 3 116 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q6GK51 9.78e-08 52 31 3 116 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain MRSA252)
Q57QC3 9.87e-08 52 28 2 106 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella choleraesuis (strain SC-B67)
O14283 9.95e-08 52 29 2 103 1 prr1 Transcription factor prr1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P60610 9.98e-08 52 31 3 116 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain N315)
P60609 9.98e-08 52 31 3 116 1 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HJB5 9.98e-08 52 31 3 116 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain COL)
P60611 9.98e-08 52 31 3 116 1 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FK09 9.98e-08 52 31 3 116 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain USA300)
P0AEV3 1.03e-07 52 32 2 103 3 rssB Regulator of RpoS Shigella flexneri
P0AEV1 1.03e-07 52 32 2 103 1 rssB Regulator of RpoS Escherichia coli (strain K12)
P0AEV2 1.03e-07 52 32 2 103 3 rssB Regulator of RpoS Escherichia coli O157:H7
Q8NYH3 1.04e-07 52 31 3 116 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain MW2)
Q6GCL1 1.04e-07 52 31 3 116 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain MSSA476)
P94413 1.05e-07 52 25 1 93 3 yclJ Uncharacterized transcriptional regulatory protein YclJ Bacillus subtilis (strain 168)
Q9LZJ8 1.12e-07 52 28 3 108 2 ARR20 Putative two-component response regulator ARR20 Arabidopsis thaliana
P13632 1.13e-07 52 30 3 129 1 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Rhizobium meliloti (strain 1021)
O83639 1.2e-07 52 31 4 113 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Treponema pallidum (strain Nichols)
Q8GP20 1.22e-07 51 27 2 122 1 rssB Swarming motility regulation protein RssB Serratia marcescens
O34903 1.25e-07 51 28 2 105 3 ykoG Uncharacterized transcriptional regulatory protein YkoG Bacillus subtilis (strain 168)
Q54RP6 1.27e-07 52 29 3 120 3 dhkL Hybrid signal transduction histidine kinase L Dictyostelium discoideum
O87717 1.29e-07 52 32 3 125 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P0AFU5 1.31e-07 52 26 2 126 1 qseF Transcriptional regulatory protein QseF Escherichia coli O157:H7
P0AFU4 1.31e-07 52 26 2 126 1 glrR Transcriptional regulatory protein GlrR Escherichia coli (strain K12)
Q6BGW4 1.4e-07 51 30 1 110 3 SRR1 Stress response regulator protein 1 Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968)
Q9KLK7 1.49e-07 52 30 4 124 1 luxQ Autoinducer 2 sensor kinase/phosphatase LuxQ Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q44929 1.54e-07 51 28 3 121 3 gtcR Response regulator GtcR Aneurinibacillus migulanus
P40138 1.55e-07 52 29 2 119 1 cyaB Adenylate cyclase 2 Stigmatella aurantiaca
Q8RAZ3 1.6e-07 52 33 3 110 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
B8B3I4 1.68e-07 52 26 3 107 3 RR22 Two-component response regulator ORR22 Oryza sativa subsp. indica
Q5SML5 1.77e-07 52 26 3 107 2 RR22 Two-component response regulator ORR22 Oryza sativa subsp. japonica
P0DMI2 1.84e-07 51 35 1 80 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R4K0 1.84e-07 51 35 1 80 1 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
P44918 1.91e-07 51 30 2 105 3 arcA Aerobic respiration control protein ArcA homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q0D3B6 2e-07 51 31 2 109 2 PRR37 Two-component response regulator-like PRR37 Oryza sativa subsp. japonica
P39928 2e-07 52 30 2 110 1 SLN1 Osmosensing histidine protein kinase SLN1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
O07528 2.15e-07 50 30 4 110 3 yhcZ Uncharacterized transcriptional regulatory protein YhcZ Bacillus subtilis (strain 168)
Q05522 2.21e-07 51 31 4 125 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Bacillus subtilis (strain 168)
P33112 2.25e-07 50 29 4 120 3 spaR Transcriptional regulatory protein SpaR Bacillus subtilis
Q5A4X5 2.39e-07 51 27 2 117 3 SKN7 Transcription factor SKN7 Candida albicans (strain SC5314 / ATCC MYA-2876)
A2YQ93 2.45e-07 51 31 2 109 2 PRR37 Two-component response regulator-like PRR37 Oryza sativa subsp. indica
Q6YVX7 2.54e-07 50 25 2 144 2 RR2 Two-component response regulator ORR2 Oryza sativa subsp. japonica
Q4GZK9 2.54e-07 50 25 2 144 2 RR2 Two-component response regulator ORR2 Oryza sativa subsp. indica
Q2T8Y6 2.59e-07 51 33 3 109 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q9ZHD3 2.77e-07 50 26 3 119 3 silR Probable transcriptional regulatory protein SilR Salmonella typhimurium
Q1CWZ9 2.93e-07 51 34 3 118 3 cheB5 Protein-glutamate methylesterase/protein-glutamine glutaminase 5 Myxococcus xanthus (strain DK1622)
P0ACZ8 3.13e-07 50 23 2 121 1 cusR Transcriptional regulatory protein CusR Escherichia coli (strain K12)
P0ACZ9 3.13e-07 50 23 2 121 3 cusR Transcriptional regulatory protein CusR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AD00 3.13e-07 50 23 2 121 3 cusR Transcriptional regulatory protein CusR Escherichia coli O157:H7
Q54U87 3.2e-07 51 27 3 118 1 dhkA Hybrid signal transduction histidine kinase A Dictyostelium discoideum
Q8TLG9 3.39e-07 50 37 1 89 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q311M8 3.61e-07 50 31 4 121 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q7A7X9 3.7e-07 50 32 2 111 1 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain N315)
Q99X00 3.7e-07 50 32 2 111 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q7MD16 4.02e-07 50 28 2 118 3 luxQ Autoinducer 2 sensor kinase/phosphatase LuxQ Vibrio vulnificus (strain YJ016)
Q8D5Z6 4.06e-07 50 28 2 118 3 luxQ Autoinducer 2 sensor kinase/phosphatase LuxQ Vibrio vulnificus (strain CMCP6)
P39048 4.08e-07 50 35 0 74 2 patA Protein PatA Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
P0DOA0 4.22e-07 50 33 4 121 1 cckA Sensor kinase CckA Brucella abortus (strain 2308)
Q2W2W9 4.38e-07 50 30 2 106 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
P23221 4.47e-07 50 30 3 107 3 fixJ Transcriptional regulatory protein FixJ Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q888V8 4.47e-07 50 30 3 115 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q2SPQ1 4.62e-07 50 29 4 131 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Hahella chejuensis (strain KCTC 2396)
P9WGN1 4.78e-07 50 33 2 103 1 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGN0 4.78e-07 50 33 2 103 3 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P10046 4.89e-07 50 31 3 121 3 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Rhizobium leguminosarum
Q39T95 5.03e-07 50 29 4 124 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q04849 5.1e-07 50 32 4 109 3 ntrX Nitrogen assimilation regulatory protein NtrX Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
P62640 5.38e-07 50 28 4 121 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
O82798 5.43e-07 50 28 3 121 1 ARR4 Two-component response regulator ARR4 Arabidopsis thaliana
Q39WQ9 5.66e-07 50 31 4 114 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q54YZ9 5.99e-07 50 25 2 118 3 dhkJ Hybrid signal transduction histidine kinase J Dictyostelium discoideum
Q8EQW0 6.18e-07 50 31 3 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
P52928 6.35e-07 50 31 0 94 3 spo0A Stage 0 sporulation protein A Bacillus anthracis
Q2IQS6 6.36e-07 50 33 4 123 3 cheB5 Protein-glutamate methylesterase/protein-glutamine glutaminase 5 Anaeromyxobacter dehalogenans (strain 2CP-C)
Q54Q69 6.95e-07 50 26 2 123 3 dhkG Hybrid signal transduction histidine kinase G Dictyostelium discoideum
Q9C5U0 7.17e-07 50 30 3 126 1 AHK4 Histidine kinase 4 Arabidopsis thaliana
A1A699 7.25e-07 50 29 5 140 1 HK6 Probable histidine kinase 6 Oryza sativa subsp. japonica
Q8NYJ9 7.38e-07 49 31 2 111 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain MW2)
Q6GCQ3 7.38e-07 49 31 2 111 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain MSSA476)
Q5HJF7 7.38e-07 49 31 2 111 2 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain COL)
Q2G1E1 7.38e-07 49 31 2 111 1 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FK47 7.38e-07 49 31 2 111 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain USA300)
Q9RC52 8.06e-07 49 28 2 102 3 citT Transcriptional regulatory protein CitT Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q6GK93 8.23e-07 49 31 2 111 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain MRSA252)
Q9HUI3 8.32e-07 50 30 2 120 3 aruS Sensor histidine kinase AruS Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P59342 8.43e-07 50 28 4 122 3 barA Signal transduction histidine-protein kinase BarA Shigella flexneri
P0A4I4 8.44e-07 49 32 0 94 3 spo0A Stage 0 sporulation protein A Bacillus thuringiensis
P0A4I3 8.44e-07 49 32 0 94 3 spo0A Stage 0 sporulation protein A Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q2YV56 8.73e-07 49 31 2 111 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2INJ8 8.91e-07 49 30 4 123 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Anaeromyxobacter dehalogenans (strain 2CP-C)
P52938 9.14e-07 49 31 0 76 3 spo0A Stage 0 sporulation protein A homolog Clostridioides difficile
Q9C5U1 9.64e-07 49 27 3 137 1 AHK3 Histidine kinase 3 Arabidopsis thaliana
Q9HV32 9.69e-07 49 32 1 81 1 pmrA Response regulator protein PmrA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q3IRR4 1.01e-06 49 29 1 110 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
P54884 1.06e-06 48 30 1 91 3 rgx3 Sensory transduction protein RegX3 Mycobacterium leprae (strain TN)
Q942A1 1.07e-06 49 25 2 133 2 RR4 Two-component response regulator ORR4 Oryza sativa subsp. japonica
Q4GZK7 1.07e-06 49 25 2 133 2 RR4 Two-component response regulator ORR4 Oryza sativa subsp. indica
Q2WAJ8 1.07e-06 49 33 4 114 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
P48027 1.11e-06 49 27 2 115 3 gacS Sensor protein GacS Pseudomonas syringae pv. syringae
P0AEC5 1.13e-06 49 28 4 122 1 barA Signal transduction histidine-protein kinase BarA Escherichia coli (strain K12)
P0AEC6 1.13e-06 49 28 4 122 1 barA Signal transduction histidine-protein kinase BarA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEC7 1.13e-06 49 28 4 122 3 barA Signal transduction histidine-protein kinase BarA Escherichia coli O157:H7
Q65JK6 1.16e-06 49 34 3 108 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
P39663 1.27e-06 48 28 4 119 1 sphR Alkaline phosphatase synthesis transcriptional regulatory protein SphR Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q54YH4 1.28e-06 49 28 4 127 1 dhkB Hybrid signal transduction histidine kinase B Dictyostelium discoideum
P62647 1.29e-06 49 29 5 127 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
Q01473 1.34e-06 49 31 4 107 3 rcaC Protein RcaC Microchaete diplosiphon
Q01473 1.46e-05 46 24 1 119 3 rcaC Protein RcaC Microchaete diplosiphon
Q2QXY3 1.35e-06 48 25 3 121 2 RR10 Two-component response regulator ORR10 Oryza sativa subsp. japonica
B8BLZ4 1.35e-06 48 25 3 121 2 RR10 Two-component response regulator ORR10 Oryza sativa subsp. indica
P44845 1.36e-06 48 26 3 121 3 narP Nitrate/nitrite response regulator protein homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q2RAP3 1.37e-06 48 25 3 121 2 RR9 Two-component response regulator ORR9 Oryza sativa subsp. japonica
Q4GZK2 1.37e-06 48 25 3 121 2 RR9 Two-component response regulator ORR9 Oryza sativa subsp. indica
Q30RX5 1.49e-06 48 33 4 112 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
Q44006 1.54e-06 48 27 2 121 2 czcR Transcriptional activator protein CzcR Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
P44895 1.57e-06 48 34 2 79 3 cpxR Transcriptional regulatory protein CpxR homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P38889 1.7e-06 48 25 2 109 1 SKN7 Transcription factor SKN7 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
G7WMP8 1.89e-06 47 25 3 130 1 filR2 Probable methanogenesis regulatory protein FilR2 Methanothrix harundinacea (strain 6Ac)
Q9HV27 1.91e-06 48 35 0 65 1 PA4781 Cyclic di-GMP phosphodiesterase PA4781 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P30843 2.04e-06 48 31 1 85 1 basR Transcriptional regulatory protein BasR Escherichia coli (strain K12)
Q4ZYD3 2.16e-06 48 29 3 115 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Pseudomonas syringae pv. syringae (strain B728a)
Q47GX7 2.55e-06 48 28 4 128 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Dechloromonas aromatica (strain RCB)
Q2ILG8 2.56e-06 48 30 3 124 3 cheB6 Protein-glutamate methylesterase/protein-glutamine glutaminase 6 Anaeromyxobacter dehalogenans (strain 2CP-C)
Q2RUI8 2.61e-06 48 29 4 124 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
P42012 2.65e-06 48 31 2 98 3 spo0A Stage 0 sporulation protein A Lysinibacillus sphaericus
Q47456 2.79e-06 48 27 2 105 3 pcoR Transcriptional regulatory protein PcoR Escherichia coli
Q9C5U2 2.84e-06 48 27 4 143 1 AHK2 Histidine kinase 2 Arabidopsis thaliana
P0DMK7 2.86e-06 47 26 2 121 3 irlR Transcriptional activator protein IrlR Burkholderia pseudomallei (strain K96243)
I1WSZ4 2.86e-06 47 26 2 121 3 irlR Transcriptional activator protein IrlR Burkholderia pseudomallei (strain 1026b)
Q7MM78 2.87e-06 48 23 2 117 3 luxO Regulatory protein LuxO Vibrio vulnificus (strain YJ016)
Q8CWJ5 2.87e-06 48 23 2 117 3 luxO Regulatory protein LuxO Vibrio vulnificus (strain CMCP6)
Q6K8X6 2.9e-06 48 26 3 107 2 RR23 Two-component response regulator ORR23 Oryza sativa subsp. japonica
B8AEH1 2.9e-06 48 26 3 107 3 RR23 Two-component response regulator ORR23 Oryza sativa subsp. indica
P0CL17 3.14e-06 47 29 1 89 2 tctD Transcriptional regulatory protein TctD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
E1WA34 3.14e-06 47 29 1 89 3 tctD Transcriptional regulatory protein TctD Salmonella typhimurium (strain SL1344)
Q9K998 3.24e-06 47 27 3 126 3 dctR Probable C4-dicarboxylate response regulator DctR Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q2RKH8 3.47e-06 48 32 2 120 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
A0A4P7TS68 3.77e-06 47 27 4 125 1 ompR DNA-binding dual transcriptional regulator OmpR Shigella flexneri serotype 5a (strain M90T)
P0AA21 3.77e-06 47 27 4 125 3 ompR DNA-binding dual transcriptional regulator OmpR Shigella flexneri
P0AA19 3.77e-06 47 27 4 125 3 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A0A0H3NGY1 3.77e-06 47 27 4 125 3 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhimurium (strain SL1344)
P0AA20 3.77e-06 47 27 4 125 1 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhi
P0AA16 3.77e-06 47 27 4 125 1 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli (strain K12)
P0AA17 3.77e-06 47 27 4 125 3 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AA18 3.77e-06 47 27 4 125 3 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli O157:H7
Q48ND9 3.93e-06 47 29 3 115 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q3SIG0 3.97e-06 47 33 4 109 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Thiobacillus denitrificans (strain ATCC 25259)
Q820K0 3.97e-06 47 33 4 111 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
P13800 4.05e-06 47 27 2 121 1 degU Transcriptional regulatory protein DegU Bacillus subtilis (strain 168)
P62646 4.42e-06 47 29 3 110 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
P54302 4.49e-06 47 29 2 115 1 luxQ Autoinducer 2 sensor kinase/phosphatase LuxQ Vibrio harveyi
Q689G9 4.53e-06 47 31 0 64 1 PRR1 Two-component response regulator-like PRR1 Oryza sativa subsp. japonica
Q9WYN9 4.54e-06 47 31 3 116 1 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q87GU5 4.58e-06 47 27 2 115 3 luxQ Autoinducer 2 sensor kinase/phosphatase LuxQ Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P42421 4.6e-06 47 25 2 112 3 yxdJ Transcriptional regulatory protein YxdJ Bacillus subtilis (strain 168)
P10577 4.61e-06 47 30 2 105 1 ntrC DNA-binding transcriptional regulator NtrC Rhizobium meliloti (strain 1021)
P69228 4.66e-06 47 26 2 107 1 baeR Transcriptional regulatory protein BaeR Escherichia coli (strain K12)
P69229 4.66e-06 47 26 2 107 1 baeR Transcriptional regulatory protein BaeR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
O34951 4.74e-06 47 20 2 122 3 bceR Sensory transduction protein BceR Bacillus subtilis (strain 168)
Q2YZ24 4.85e-06 47 31 3 124 3 hssR Heme response regulator HssR Staphylococcus aureus (strain bovine RF122 / ET3-1)
P09432 4.88e-06 47 28 2 121 3 ntrC DNA-binding transcriptional regulator NtrC Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q7NZB3 5e-06 47 28 4 124 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
P0C5S5 5.06e-06 47 23 2 117 3 luxO Luminescence regulatory protein LuxO Vibrio harveyi
A7MVC2 5.06e-06 47 23 2 117 1 luxO Luminescence regulatory protein LuxO Vibrio campbellii (strain ATCC BAA-1116)
Q20XK3 5.13e-06 47 29 2 107 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Rhodopseudomonas palustris (strain BisB18)
Q9KL96 5.17e-06 47 28 3 124 3 VC_A0850 Uncharacterized response regulatory protein VC_A0850 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q12IZ9 5.18e-06 47 30 3 105 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q1MP86 5.2e-06 47 34 3 104 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Lawsonia intracellularis (strain PHE/MN1-00)
Q8L9Y3 5.49e-06 47 26 3 123 1 ARR14 Two-component response regulator ARR14 Arabidopsis thaliana
Q87MX7 5.52e-06 47 23 2 117 3 luxO Regulatory protein LuxO Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
O80365 5.55e-06 47 31 0 67 1 ARR8 Two-component response regulator ARR8 Arabidopsis thaliana
P52929 5.57e-06 47 27 0 94 3 spo0A Stage 0 sporulation protein A (Fragment) Brevibacillus parabrevis
Q49ZT8 5.63e-06 47 27 2 122 3 hssR Heme response regulator HssR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q3ADA6 5.66e-06 47 30 3 108 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
A6WZ81 5.69e-06 47 27 4 108 3 ctrA Cell cycle response regulator CtrA Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q31HL9 5.8e-06 47 31 3 108 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
O80366 5.86e-06 47 24 2 136 1 ARR9 Two-component response regulator ARR9 Arabidopsis thaliana
Q8FZ93 5.92e-06 47 27 4 108 1 ctrA Cell cycle response regulator CtrA Brucella suis biovar 1 (strain 1330)
B0CI76 5.92e-06 47 27 4 108 3 ctrA Cell cycle response regulator CtrA Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VRW9 5.92e-06 47 27 4 108 1 ctrA Cell cycle response regulator CtrA Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q7CNV1 5.92e-06 47 27 4 108 1 ctrA Cell cycle response regulator CtrA Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A9M708 5.92e-06 47 27 4 108 3 ctrA Cell cycle response regulator CtrA Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q9ZHS1 5.92e-06 47 27 4 108 1 ctrA Cell cycle response regulator CtrA Brucella abortus biovar 1 (strain 9-941)
Q2YQA4 5.92e-06 47 27 4 108 1 ctrA Cell cycle response regulator CtrA Brucella abortus (strain 2308)
B2S753 5.92e-06 47 27 4 108 3 ctrA Cell cycle response regulator CtrA Brucella abortus (strain S19)
Q52376 6.05e-06 47 28 3 121 3 gacA Response regulator GacA Pseudomonas syringae pv. syringae (strain B728a)
Q167K9 6.2e-06 47 33 4 106 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
P95582 6.23e-06 47 28 3 121 3 gacA Response regulator GacA Pseudomonas viridiflava
Q0WPQ2 6.23e-06 47 29 4 128 1 ETR2 Ethylene receptor 2 Arabidopsis thaliana
Q5GYV8 6.25e-06 47 30 3 108 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P1V8 6.25e-06 47 30 3 108 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
A1A697 6.44e-06 47 26 4 126 2 HK5 Probable histidine kinase 5 Oryza sativa subsp. japonica
P45365 6.46e-06 47 25 1 108 3 None Uncharacterized 76.5 kDa protein in phbC 3'region Thiocystis violacea
P87323 6.73e-06 47 25 3 143 4 mcs4 Response regulator mcs4 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q9LVG4 6.8e-06 47 30 2 115 1 APRR3 Two-component response regulator-like APRR3 Arabidopsis thaliana
Q6LU34 6.84e-06 47 31 3 105 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Photobacterium profundum (strain SS9)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_02680
Feature type CDS
Gene cheY
Product chemotaxis response regulator CheY
Location 510242 - 510634 (strand: -1)
Length 393 (nucleotides) / 130 (amino acids)
In genomic island -

Contig

Accession ZDB_519
Length 680340 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_556
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00072 Response regulator receiver domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0784 Signal transduction mechanisms (T) T CheY-like REC (receiver) domain, includes chemotaxis protein CheY and sporulation regulator Spo0F

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03413 two-component system, chemotaxis family, chemotaxis protein CheY Two-component system
Bacterial chemotaxis
-

Virulence factor Annotation(s)

VF gene ID Protein VF ID Category
VFG043206 chemotaxis regulatory protein CheY VF0394 Motility

Protein Sequence

MAAKDLNFLVVDDFSTMRRIVRNLLKELGYNKIEEAEDGVDALEKIRAGQIDFVVADWNMPNMDGLELLKTIRADDALKHIPVMMVTAEAKKENIIAAAQAGASGYVVKPFTAAILEEKLNKVFEKMGLN

Flanking regions ( +/- flanking 50bp)

TCCGCCTGACGGAACCGGCAATTATTCATTGTATTATTGCAGGAGTGGTTATGGCCGCTAAAGATTTGAATTTTCTGGTAGTTGATGATTTTTCCACCATGCGCCGTATCGTGCGTAACCTCTTAAAAGAGTTGGGCTACAACAAAATTGAAGAGGCGGAAGACGGTGTGGATGCACTGGAGAAAATCCGTGCAGGTCAGATTGATTTCGTGGTGGCTGACTGGAACATGCCGAACATGGACGGGCTGGAGCTGCTGAAAACCATCCGCGCGGATGATGCACTCAAACATATCCCGGTCATGATGGTGACCGCCGAAGCGAAAAAAGAAAATATTATTGCCGCCGCTCAGGCCGGTGCCAGCGGTTATGTTGTCAAGCCGTTCACTGCCGCGATCCTCGAGGAAAAACTGAATAAAGTCTTCGAAAAAATGGGTCTGAACTGAGGGGCTTCAGCAGAAGGAAAGCAGGATGACGGAAAATAAATCAACGGACA